(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE297

MICSR_1.PE297        Location/Qualifiers
FT   CDS_pept        join(591004..591053,591270..591425,591582..594900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636927"
FT                   /orf_name="MICPUN_99422"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO61742.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199A654"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H4"
FT                   /transl_table=1
FT                   /translation="MPLVRSNDAPDSADPVRSGAIFGLVPSTGAPPHDAHPGSPGGGFG
FT                   GSPYGGGGSYGGDTRETQQYTDYQNMGNGWVQRTRRSTVERVIERVHTDVDEMVPMRGG
FT                   AGGAHLHGGGGGGLVPHGGPGSNGWLNGELARQVHSKFEDMVRQSPAPTRAERSAYDEL
FT                   VRSFPPPESRGRLALGDGSGIEREPQPGIVSPTGGYAAPWMNGGGGGGGAGGDGRYPSR
FT                   LGHNTAGDGDNTAGGVDANGSPAERSIFSDLKSPPPSMRRASGGGGSGSGFTLDDLILR
FT                   KKGPDAAAARGAIFSPPPSPPGGRGRGRGRRGRKPGAGAGAKKPSPPPEPSESSSESED
FT                   ADEDADDDYVSPAGVEGGRDASSPLEKLARAAEKRGATRAGASPRVTVGKSPAKSPASL
FT                   TARAARRSYRIGDSDSDDDGNKIAAVRAGRTKPSTGVGGNKRGSREARQLLIAAQRMAR
FT                   VTGGGGAGASGVVATATTPAAASPSALRGAGTPASVGGRSGGRSTRERRAPSAFWLNED
FT                   AKRKDPFATTATPAATSAAAESKKTAARAKPGPKAKKPAAKRGRPKSKAKPAAKRRRDD
FT                   DDDDDDDDGESSSSESESESESEESEEEETLEARAARTSAVKKSVAKKSAVKSPAKRPR
FT                   GRSPTKGPTRARPAKKPSKSLAVYSESEDATDEDEDEEDEEDEDEEDEDDDVPPPKGDD
FT                   DTEESDGDDTEESDEDSEDDTPLASRYKGKPSKAAASPKGKKPPPAAKPKPKPSPKPAK
FT                   PSPGKGNRRHSAEHAAALVSAEIMGRKTSMARRFGLNVARVVDSEAESSDDDEEEGEDD
FT                   DDAGPPGSTPTDRSSDRTEASSPATATTDADGGAADTTDADDTPATKGSAGGQPPRSIE
FT                   KGKRGGWRPGAGRPRKVYDPNDPTPRKRRRLPGEPPRKRGRPRKHPTAEDIEAGHIRRK
FT                   PASAEEKAAALRRLAGGIGGIFGQDVAAPKPRGRPRKDGSSKSAPPKPSGADNKPARET
FT                   PAPAVRANAISTERWAARVKKAFAGGNAEASHPDSPPRRREVSFPENEGEGAAGAEPRD
FT                   GAASAPRSAPPAPPPSGRYGSDRENEQVSAAKSSRRKSILRTLGKSLGEENERDARRNA
FT                   LDRRYSDVPEFEVFGFQGTPEKGGAASPDFGGSPGLFTAKSPGGLISQLDTDTPVTSPV
FT                   RSSPRLRG"
     atgcccctcg tcaggagcaa cgatgcgccg gacagcgccg atccagtgag gtccggcgcc        60
     atattcggtc tggtgccgtc caccggtgca ccgcctcacg atgcgcatcc tggaagcccc       120
     ggcggagggt tcgggggcag cccgtacggc ggcgggggct catacggcgg cgatacgcgc       180
     gagacgcagc agtacaccga ctaccagaac atgggtaacg gttgggtcca gcgcacgcgc       240
     cgcagcaccg tggagcgcgt gatcgagcgc gtgcacaccg acgtcgacga gatggtcccg       300
     atgcgaggag gcgcgggcgg cgcacacctt cacggcggcg gcggcggagg cctcgtccca       360
     cacggcggcc ccggatccaa cggctggctc aacggcgagc tcgccaggca agtgcacagc       420
     aagttcgagg acatggtgcg ccagtccccg gcgccgactc gcgcggagag gtccgcgtac       480
     gacgagctcg tgcgatcgtt tccaccgccg gaatcgcgcg ggcggctggc gctcggagac       540
     ggctccggca tagagcgtga acctcaaccc gggatcgtca gcccgacggg ggggtacgcg       600
     gcgccgtgga tgaacggcgg cggcggcggc ggcggcgcgg gcggcgacgg gcggtacccg       660
     tcgcgcctgg gccacaacac agctggcgac ggcgacaaca cagctggcgg ggttgatgcc       720
     aacggctcgc ccgccgagcg aagcatcttc tccgacctca agtccccgcc gccgtcgatg       780
     cgaagggcat cgggcggggg tggttccgga tcggggttca cgctcgacga cctcatcctc       840
     cgcaagaagg gcccggacgc ggcggcggct cgaggcgcga tattctcgcc gcccccgtcg       900
     ccccccgggg gccggggccg gggccgcggc cgacgcgggc gcaagccggg cgccggcgcc       960
     ggcgccaaga agccgagtcc cccgccagaa ccctcggagt cgtcgtctga gtccgaggac      1020
     gccgacgagg acgccgacga cgactacgtg tccccggcgg gggtcgaggg gggacgcgac      1080
     gcgtcttcgc cgctcgagaa actcgcaagg gcggcggaga agaggggcgc gacgcgagcg      1140
     ggcgcgtcac cgcgcgtcac cgttggaaaa tcgccagcca aatcgcccgc gtccttaacc      1200
     gctcgcgccg cgcgccgctc gtaccgcatc ggcgacagcg acagcgacga cgacgggaac      1260
     aagatcgccg ctgttcgagc ggggcgtaca aaacccagca caggcgtcgg cggtaacaag      1320
     cgtggctcgc gcgaggcgag gcagctcctc atcgccgcgc agcgcatggc gagggtgacc      1380
     ggcggcggcg gcgcgggtgc ctcgggggtg gtcgcgacgg cgacgacccc ggcggcggcg      1440
     tccccgtcgg cactccgggg cgcgggtact ccggcgtccg tcggcgggag gagcggcggg      1500
     aggagcacgc gcgagcgcag agcgccgagc gcgttctggc tcaacgagga cgccaagcgt      1560
     aaggatccgt tcgcgacgac ggcgacgccg gcggcgacgt cggcggcggc ggagtccaag      1620
     aagacggcgg cgagggcgaa gcccggtccg aaggcgaaga agccggcggc gaagagggga      1680
     aggcccaagt cgaaggccaa gccggcggcg aagaggcggc gggacgacga cgacgacgac      1740
     gacgacgatg acggcgagtc gtcttcatcg gaatccgagt ccgagtccga gtctgaggag      1800
     tcggaggagg aggagacgct cgaggcgcgc gcggcgagga cgtccgcggt gaagaagtcc      1860
     gtggcgaaga agtccgcggt gaagtctccg gcgaagaggc cgaggggtcg aagcccgacg      1920
     aaggggccga cgcgggctcg acccgcgaag aaaccctcga agagtctggc ggtgtattca      1980
     gagtctgagg atgcgacgga cgaggacgag gacgaggagg acgaggagga cgaggacgag      2040
     gaggacgagg acgacgacgt ccctccgccg aagggggatg acgacacgga ggaatctgac      2100
     ggcgacgaca cggaggaatc ggacgaagat tccgaggacg acaccccgct ggcgtcgagg      2160
     tacaagggaa agccgtccaa ggcggcggcg tcgcccaagg ggaagaagcc tcctcccgcc      2220
     gcgaagccca agcccaagcc ctcgcccaag ccggccaagc cctcgcccgg gaagggtaac      2280
     cggcggcact ccgcggagca cgcagccgcg ctcgtcagcg ccgagatcat gggccggaag      2340
     acgagcatgg cccgcaggtt cggcttgaac gtcgcccggg tcgtcgactc ggaggcggag      2400
     tcgtcggatg acgacgagga ggagggcgag gatgacgacg acgccggtcc gccggggtcg      2460
     acccccacgg acagatcctc ggaccggacg gaggcgtcct ccccggcgac ggctacgacg      2520
     gacgcggacg ggggcgccgc ggacaccacg gacgcggacg atacccccgc gacgaagggg      2580
     tcggcgggag ggcaaccccc gcggagcatc gagaagggca aacgcggggg ttggaggccc      2640
     ggcgcgggca ggccgaggaa agtttatgac ccgaacgatc cgactccgcg gaagaggcga      2700
     aggctcccgg gggagccgcc gcgcaagcgc ggcaggccgc gcaagcaccc caccgcggag      2760
     gacatcgagg ctgggcacat ccggcgaaag ccggcgagcg cagaggagaa ggcggcggcg      2820
     ctgcggaggc tcgccggcgg catcggcggc atcttcggcc aggacgtcgc cgctccaaag      2880
     ccgcggggta ggcccaggaa ggacggttcc tccaagagcg ctccgccgaa gccctccggg      2940
     gcggataaca agcctgcccg cgagactccc gcgccggcgg tgagggcgaa cgcgatcagc      3000
     accgaacgat gggcggctcg ggtcaagaag gcgtttgccg gggggaacgc ggaggcttct      3060
     cacccggatt cgccgccgcg gaggcgcgag gtttccttcc cggagaacga gggcgagggc      3120
     gccgccgggg cggaaccgcg agatggagcc gcgagtgccc cgaggagtgc gccgccggcg      3180
     ccgccgccgt ccggccggta cggatcggac cgcgagaacg agcaggtttc cgccgccaag      3240
     tcctcgcggc gcaagtccat cctgcggacg ctgggcaagt cgctgggcga ggagaacgag      3300
     agagacgcga ggcgaaacgc gctggacagg cgatacagcg acgtccccga gtttgaggtg      3360
     tttgggtttc agggtacgcc cgagaagggc ggggcggcga gcccggactt tggcgggtca      3420
     cccgggctgt tcacggcaaa gtcaccgggg ggtttgatca gccagttaga cacggacacc      3480
     ccggtgacgt cgccggtgcg atcctctccg agacttcgcg gttga                      3525
//

If you have problems or comments...

PBIL Back to PBIL home page