(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE298

MICSR_1.PE298        Location/Qualifiers
FT   CDS_pept        complement(595008..596393)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636928"
FT                   /orf_name="MICPUN_56875"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62168.1"
FT                   /db_xref="UniParc:UPI000199A655"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H5"
FT                   /transl_table=1
FT                   /translation="MARRADVLLASVLGVAVTLTLASLVVDATDARAREPRDPAEKPGA
FT                   SPCWARSPTNASRLVPKEGGCDGFDADEVGGVDRARKLDECACVYAQAVCDVQPGLVCS
FT                   VPDGRYVCRDEATGAVGGTAGQELRVPCLQSLCTSVTCPLDPRTLPLGDDGASAAKVCD
FT                   VCEMYGYAAGTGELRAQEGSRCGGEVRAQGLRFGPKAALLAYSAFMFVDFTMAAAAAGK
FT                   PLPQDLPTTSQYPEYHHGQPSAPVLLPEILEQDTGGDWQTTTTAYEYPPTTTTYEYPPT
FT                   PPTPPSPSQHPSRPPPLPSLCDVDDLMDVLPSALPSLVPCLSGSTSTCCQNVANIVGES
FT                   TDADMTDCLCNRDAFDALAGLLMDNVGLDLASRLGECVAKGYRINFPADEGGGGGCDRY
FT                   EKRETRAYVRPRTERKGVEESGDPDAVARDRPRASVTAQSRARNAAGPRAGSDEAPARG
FT                   DDR"
     atggcacgcc gcgcggatgt cctcctggcc tcggtcctcg gcgtcgcggt gaccctcacg        60
     ctcgcgtccc tggtggtgga cgcgacggac gcgcgagccc gcgagccgcg ggacccggcc       120
     gagaaacccg gagcgtcgcc gtgctgggcc cgaagcccca cgaacgcctc gaggctggtg       180
     ccaaaagagg gggggtgcga cggcttcgac gcggacgagg tgggcggcgt cgatcgcgcg       240
     cgaaagctcg acgagtgcgc ctgcgtctac gcgcaggcgg tgtgcgacgt gcagcccggc       300
     ctcgtgtgtt cggttccaga cgggcgctac gtgtgcagag acgaggctac gggcgcggtg       360
     ggcgggacag ccgggcagga gctgcgggtt ccctgccttc agagcctctg cacgtcggtg       420
     acgtgcccgc tggacccgcg aacgctgccc ttgggcgacg acggcgcgag cgccgcgaag       480
     gtgtgcgacg tgtgcgagat gtacgggtac gcggcgggta caggcgagct ccgggcccag       540
     gagggttcga ggtgcggagg cgaggtccgg gcccaaggct tgaggttcgg cccgaaggcg       600
     gcgctgctgg cgtactcagc cttcatgttt gtggacttca ccatggccgc cgcggcggcg       660
     ggcaaaccgc tgcctcagga cctgccgacg acgtcgcagt atccggagta tcatcacggc       720
     caaccgtcgg cgcccgtgtt gctcccggag atcctcgagc aagacacggg aggcgactgg       780
     caaacgacga cgaccgctta cgaatacccg ccgaccacca ccacctacga gtacccgccg       840
     acgccgccga cgccgccgtc tccgtcccaa catccgtccc gacctccgcc gcttccgtct       900
     ctgtgcgacg tggacgatct catggacgtc ctcccgtccg cgctcccttc tctcgtcccg       960
     tgcctgtccg gctcgacctc gacgtgttgc caaaacgtgg caaacatcgt gggggagtcg      1020
     acggacgctg acatgaccga ctgcctgtgc aatcgagacg ccttcgacgc cctcgcgggg      1080
     ttgctgatgg acaacgtcgg gttggacctg gcctctcgcc tgggcgagtg cgtcgcgaag      1140
     gggtatcgga tcaacttccc ggcggatgag ggcggcggcg gcgggtgcga ccggtacgaa      1200
     aaacgcgaga cgcgcgcgta tgttcggccc agaaccgaga ggaaaggagt cgaggaaagc      1260
     ggagacccgg acgcggtcgc tcgagaccga ccgagggcgt cggtgaccgc gcagagtcgc      1320
     gcgcggaacg cggcgggccc gcgcgcggga agcgacgagg cgccggcgag gggagacgat      1380
     cgataa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page