(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE299

MICSR_1.PE299        Location/Qualifiers
FT   CDS_pept        join(596525..596819,596940..598483)
FT                   /codon_start=1
FT                   /gene_family="HOG000100025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636929"
FT                   /orf_name="MICPUN_99424"
FT                   /product="JmjN/JmjC protein"
FT                   /protein_id="ACO61743.1"
FT                   /db_xref="HOGENOM:HBG560122"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000199A656"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H6"
FT                   /transl_table=1
FT                   /translation="MVAADGGAIASEPPTGRRAKRTIRAPTKFVDEDGFNDADLQRALK
FT                   ASMKHVRRVSSTTVPECPVFRPTAEQFADPFAYIKSITPEAMPYGIAKIIPPEGWKPPF
FT                   NEEAGGDGIPFDTKLQTVNRLQEGLHFEDGERYTRDSYRDMADAFKRKYLETHRRVADE
FT                   TERLRRENRGWSDDACEARALEEEFWRIVETDVEKIRVEYGSDLDADVYGSGFAKVPLG
FT                   SASAAAGATPDSDSDEDGGVPHAWDFGELIRHPSNLLRVVGGDIPGLTRPWLYFGMMFS
FT                   AFCWHVEDHYLGSVNYMHAGAPKTWYGAPTHAADAFERAVRDIVPGIFKDAPDLLHRLV
FT                   TLVPPAVLGEGHGVPVCQTLQRAGEFVVTWPRAYHAGFSHGWNVGEAVNFGTADWVPMG
FT                   RAAVNDYQHGVGKRDSIFSHEKMILDTAKAFVRRYGYGDGSSREDQSLRAPWIARMADA
FT                   LRAELQIIEKEQRAGRAVVTSKGVKEVAGKENEASKHEDEDENCALCKAMPHLAVVHCA
FT                   RCFEIAEKIEFEQAVARARAEGRSAAGAAWALQGGSSSERLRRMGRYHRRRRRNRPVFC
FT                   LGHALDGNCGHGVTELVMTTNASMDELERVLGALQK"
     atggtggccg cggacggagg cgcgatagcc tcggagcccc cgacggggcg tcgagccaag        60
     cggaccatcc gtgcgcccac caaattcgtc gacgaagacg gattcaacga cgccgatctt       120
     cagcgcgcgc tcaaggcgag catgaagcac gtccgccggg tctcctcgac gacggtgccg       180
     gagtgcccgg tgttccgccc gaccgcggag cagttcgccg atccgttcgc ctacatcaag       240
     agcatcacgc cggaagccat gccctacggc atcgcgaaga taatcccccc cgaaggatgg       300
     aagcccccgt tcaacgagga agccggcggc gacggcattc ccttcgatac taagctgcag       360
     accgtcaacc gcctccagga agggctccac ttcgaggacg gcgagaggta cacgcgcgat       420
     tcgtaccgtg acatggctga cgcgttcaag agaaagtacc tggagacgca tcggcgcgtg       480
     gcggacgaga ccgaacggct gaggagggag aaccgcggtt ggagcgacga cgcgtgcgag       540
     gcgagagcgc tggaagagga gttctggagg atcgtcgaga cggacgtcga gaagattcgc       600
     gtcgagtacg gaagcgatct agacgcggac gtgtacggca gcgggttcgc gaaggtgccg       660
     ctcgggtcgg catccgccgc cgcgggtgcg acgccggact cggattcaga cgaggacggc       720
     ggcgtgccgc acgcgtggga ctttggcgag ctcatcaggc acccgtcgaa ccttctccgc       780
     gtggtgggcg gggacatacc gggcttgacc cggccgtggc tgtactttgg catgatgttc       840
     agcgcgtttt gctggcacgt cgaggatcac tacctggggt ccgtaaacta catgcacgcg       900
     ggcgcgccga agacgtggta cggcgccccg acgcacgcgg cggatgcgtt cgagcgcgcg       960
     gtgagggaca tcgtcccggg gatcttcaag gacgcacccg acttgctgca tcggctggtc      1020
     acgctcgtgc cgccggcggt gctcggcgag ggacacggag tgccggtgtg ccagacgctg      1080
     cagcgcgcgg gcgagttcgt ggtgacgtgg ccgagggcgt accacgcggg gttttcgcac      1140
     ggctggaacg tgggcgaggc tgtgaacttc ggcaccgcgg actgggtccc gatgggcaga      1200
     gccgccgtga acgactacca gcacggcgtc ggcaagcgag actcgatctt ctcgcacgag      1260
     aagatgattc tggacaccgc gaaggcgttc gtgcggcggt acgggtacgg cgacgggtca      1320
     tcgcgggagg accagtcgct cagggcgccg tggatcgcga ggatggcgga cgcccttcgc      1380
     gccgagctcc agattatcga aaaagagcag agggcgggga gagccgtcgt gacgtcaaag      1440
     ggtgtcaagg aggttgccgg gaaggagaac gaggcttcca aacacgagga cgaggacgaa      1500
     aactgcgcgc tttgcaaggc gatgcctcac ctcgccgtcg tgcactgcgc ccgttgcttc      1560
     gaaatcgccg aaaagatcga gttcgagcag gctgtcgctc gggcgagggc ggagggccgg      1620
     agcgccgccg gcgccgcgtg ggcgcttcag ggcggatcgt cttccgagcg tctccggcgg      1680
     atggggcggt accacaggcg gcgcaggcgc aaccggccgg tgttctgcct cgggcacgcg      1740
     ctggacggaa actgcgggca cggcgtgacg gaactcgtga tgacgaccaa cgcgtcgatg      1800
     gacgaactcg agcgggtgct cggcgccctt cagaaataa                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page