(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE3

MICSR_1.PE3          Location/Qualifiers
FT   CDS_pept        complement(9334..13197)
FT                   /codon_start=1
FT                   /gene_family="HOG000231203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636008"
FT                   /orf_name="MICPUN_56574"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62030.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG505899"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022577"
FT                   /db_xref="UniParc:UPI000199AA4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N0"
FT                   /transl_table=1
FT                   /translation="MDPPTEEGFDDENELTFVKEAPEVNGLVEQIKDALEGRDPADGTS
FT                   TISKTVFHKIQEIVERYQEYPTLLDPHLEGWILPLTSVIRREAHKGSEADMVLVQRASR
FT                   VLHALASVRGYKTVVKFFPHEAKDFEPVVALLVRSHDVGSLATNMEEADELGSAWETRA
FT                   TLILWLSILVLIPFDLVTVDSQVTTNTGVDGAAMAKSGGQQEAPPVVLRILALCQDSYL
FT                   RDPGIVRDRAAFLLAKLLTRPDMPLALQKFLVWATDALGGQSEYSEQEKMFIVPGIVRA
FT                   LAATFKLGKRSELLEVAERLWTNARDLADSPAAKASTLTRKLACKLTQRIGLLFLKPRV
FT                   VSWRYERGARSLEDNLKRAMIISQGGDADAEDRKKAEEAAAKEQEEDEDWDIPEEIEEV
FT                   IEALLTALRDKDTVVRWSAAKGLGRITARLPAELGDEVVGSILDCFLPTENDNTWHGAC
FT                   LALAELSRRGLLLPVRLPDAVPHVASALAYDVRRGPHSVGAHVRDAASYVCWAFARAYA
FT                   PEVLAPHADALAPSLLIAACFDREVNCRRAASAAFQESVGRLGAFPHGIDIIQVADYFS
FT                   LGSRTKAYTVVADHICGYDEYRRRMLNHLCDVKLIHWERATRELAARTISIIGRRDPEW
FT                   IREVALPVLLDRSLSTNLEARHGACVGAAEALLALKNAGEPCVEGELATKVTGLVTAIE
FT                   KARLYRGKGGEVMRAAVSKYVQCLASVSQPLDKGPGPATGPKSLRSTLLASLEENLKHP
FT                   TVDIRDSAVSAMEEFSASYMVGSNPAAGAKRLIVKLATLLREDQNPAARRGAALALGVM
FT                   PGEMLFSCVPGFAAEAPAEENVDAEADPEMIPAWRMALEALKAASIPEEDVEARDADAR
FT                   VCATKGMAGVLSRMATNLVEDDYAATSQAASEVISSLLTCMEDYCTDNRGDVGSWVREA
FT                   AMEALPGAISALQASGLELATGRCATIVSALLKQCAEKIDRTRASAATALCAVLRGRES
FT                   DMLEPLPDVPGLNKLLDAAPTEERLAASWAVPTSAYAALTPLIVADGSDPLAAYRADLI
FT                   EGIVVSAGGVGDSLGKASGGALVAAVKADPALQETVANELVDLLSRRQGVDRVTVPLLR
FT                   VLDLLFSSGALASVAPAHPDPPNAFAHTLAENLRAELKGSRDVAKLCHGVQALSHVAAL
FT                   GPNVINSDRCARTSGLQGILALMVSRYPRVRRVASEALYVLLLGLDEEAAGEGIEAAIE
FT                   LLSDTRWDAELTMVKPERNKLYPLLGLEAPAAALEAAKGPGVKVKVVDENESYAALVGS
FT                   AGY"
     atggatcctc cgacggaaga gggtttcgac gatgagaatg agcttacatt cgtcaaggaa        60
     gcacccgaag tcaacgggct cgtggagcaa atcaaggatg cgctcgaggg gagagatccc       120
     gcagacggca cctcgacgat ctcgaaaacg gtgttccaca agatccagga gatcgtggag       180
     cggtaccagg agtatccgac gctcctggat ccgcacctgg agggatggat ccttcccctg       240
     acctcggtaa ttcgtcgtga agcccataaa ggctccgagg ctgacatggt gctcgtccag       300
     cgcgcgtcac gggtgctcca cgctctcgca tccgtccgcg gatacaagac cgtggtcaag       360
     tttttcccgc acgaggcgaa ggacttcgag ccggtggtcg ccttgctggt gcgatcgcac       420
     gacgtcggct cactcgcgac gaatatggag gaggcggatg agctcggttc cgcttgggag       480
     acgcgcgcaa ccctgatcct ttggctgtcc atcctggtgc tcatcccgtt cgacctcgtc       540
     accgtcgact cgcaggttac cacaaacacg ggcgttgacg gcgcggcaat ggccaagagt       600
     ggcgggcagc aggaggcgcc cccggtcgtg ctcaggattc tagcactgtg ccaagactcc       660
     tacctgcgcg atccggggat cgtacgagac cgagcagcgt tccttctcgc caagcttttg       720
     actcgaccgg atatgcctct cgcgctgcag aagtttttgg tttgggccac tgacgcgctc       780
     gggggccaat cggagtactc ggaacaggag aagatgttca tcgtacccgg tatcgtgcgc       840
     gcactcgcgg cgacatttaa gcttgggaaa aggtcggagc ttttggaggt tgcggagagg       900
     ttgtggacga acgcgaggga cctggcagac tcgcccgccg cgaaggcttc gacgttgacc       960
     cgtaagctgg cgtgcaagct gacgcagagg atcggtctct tgttcttgaa gccgagggtt      1020
     gtgtcttgga ggtacgaacg tggcgcgagg tcgcttgaag acaacctgaa aagggctatg      1080
     atcatcagtc aaggcggaga cgcagacgct gaggatagga aaaaggctga ggaggcggcg      1140
     gcgaaagaac aggaggaaga cgaggactgg gatatcccgg aggagatcga agaggtcata      1200
     gaggctttgc tgacagcgct acgagataag gataccgtgg ttcgctggtc cgcggcgaag      1260
     ggtctgggaa ggatcacagc tcgccttcca gcggagctcg gcgatgaggt cgtgggttcc      1320
     atccttgact gcttcttgcc cacggagaac gacaacacct ggcacggcgc ttgtttggct      1380
     ctggcggaac tgtcccgccg tggacttctc ctccccgtcc gcctaccgga tgcggtcccg      1440
     cacgtggcat cggcgctcgc gtacgacgtg cgaagaggac ctcactcggt tggcgcgcac      1500
     gttcgagacg cggcttctta cgtgtgctgg gcctttgctc gcgcgtacgc gccagaagtt      1560
     ctcgcacctc acgcagacgc tctggcgcct tccctgctga tcgcggcgtg cttcgacagg      1620
     gaggttaact gcaggcgcgc tgcttccgcc gcgttccaag agtccgtcgg tcgtctcggc      1680
     gcgttcccgc acggcatcga catcatccaa gtggcggact acttttcgct cggatccagg      1740
     accaaagcgt acaccgtcgt ggccgaccac atctgcggtt atgacgaata caggcgcagg      1800
     atgctgaacc acctgtgcga tgtgaagctg attcactggg agcgcgccac cagggagctc      1860
     gctgcgagga cgatatctat catcggccgc cgggacccgg agtggattcg ggaggttgcg      1920
     ctccccgtgt tgttggaccg gtcgctgtcg acaaacctcg aggcgagaca cggcgcgtgc      1980
     gttggcgcgg cggaggcgtt gcttgcactg aaaaatgctg gcgagccctg cgtggaggga      2040
     gaactcgcga cgaaggtcac cggcctggtg actgcaatcg agaaggctcg cctgtaccga      2100
     ggcaaaggcg gagaggtgat gcgcgcggcg gttagcaaat atgtgcagtg tctggcgtct      2160
     gtctcgcagc cgttggacaa gggaccggga cctgctacgg gtcctaagtc tttgcgttcc      2220
     acgcttctcg cctcgctaga ggagaatttg aagcatccga cggtcgacat acgtgactct      2280
     gcggtgtcgg cgatggagga gttttcggct tcatacatgg tcgggtcaaa cccagccgcg      2340
     ggtgccaaga ggctgatcgt gaaactcgcg acgctcctga gggaggacca gaacccggca      2400
     gcgaggagag gcgcagcgct cgcgctcggt gtgatgccgg gcgagatgct cttctcgtgt      2460
     gtgccaggct ttgctgccga agctccagcg gaggagaacg tggatgccga ggcagatccg      2520
     gagatgatcc ccgcgtggcg catggcactt gaggctctca aggcggcatc gatcccggag      2580
     gaagatgtcg aggcgaggga tgcggacgcg cgcgtttgcg cgacgaaggg gatggcggga      2640
     gttctgtccc ggatggcgac caatctcgtc gaggacgact acgcggcgac gtcgcaagcc      2700
     gcttcagagg tcatctcatc tctgctgacg tgcatggagg actactgcac ggacaaccga      2760
     ggtgatgtcg gctcctgggt gcgtgaggcg gcgatggagg cgcttcccgg tgccatctca      2820
     gctctgcagg cttcgggact cgagctcgcg acgggaaggt gcgcgacaat cgtatcggcg      2880
     ctgctcaagc agtgtgccga gaagattgat cgcacgaggg cgtcggcggc gactgctctt      2940
     tgcgcggtgc tccgcggccg ggagtcggac atgctcgagc cgctgccgga cgtacctggt      3000
     ttgaacaagt tattggatgc ggcgcccacg gaggagagac tcgccgcgtc gtgggctgtt      3060
     cctacaagcg cgtacgcggc gttgacacca ctcattgtcg cggacgggtc tgatccactc      3120
     gcggcgtaca gggcggacct catcgagggg atcgtggtgt ccgccggtgg cgtcggagat      3180
     agcctcggca aggcttctgg aggtgcccta gttgccgcag tcaaggctga ccccgcgctg      3240
     caggagaccg tggcgaacga gctggttgac ctgttgtctc gccgccaagg cgtggacagg      3300
     gtcaccgtgc cgctgctccg cgtcttggac ttgctgtttt cgtccggggc gctcgcctca      3360
     gtcgctcctg cacatcccga cccgcctaat gcgttcgcgc acacgctcgc cgaaaatctc      3420
     cgtgccgagc tcaaagggtc cagagacgta gctaagctat gccatggtgt ccaggctctc      3480
     tcacacgttg ccgcgcttgg acccaacgtg ataaactcgg acagatgcgc gaggacgtct      3540
     ggacttcaag gtatacttgc actgatggtg agcaggtatc ccagggttcg cagggtcgct      3600
     tccgaggcgt tatacgtttt acttctaggt ttagacgagg aggctgccgg cgagggtatc      3660
     gaggcggcga ttgagttact ctccgataca aggtgggacg cggagctcac catggtcaaa      3720
     ccagagagga acaaactgta tccgctccta ggtctggagg ctcccgcggc ggcgctcgag      3780
     gcggcgaagg gtccgggtgt caaggtcaag gtggttgacg agaatgagtc atacgcagcg      3840
     ctggttggga gcgctggata ttga                                             3864
//

If you have problems or comments...

PBIL Back to PBIL home page