(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE30

MICSR_1.PE30         Location/Qualifiers
FT   CDS_pept        complement(51506..52540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636035"
FT                   /orf_name="MICPUN_107850"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62044.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199AB26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q7"
FT                   /transl_table=1
FT                   /translation="MAYISVVLNDWKYSCPIVWSFYSTALAAGRENGKLRREVEQNLRL
FT                   KYSKELPPPNTSSEPPSEKSMKSGIKSGMKGVAKGMTDVAKVTSGGLTYLLFGGKDDMS
FT                   NEMREELEVELDKIRRSRRARTRWFLALTLMNNPSLIAMRRPWGGQPQNVAMLKPSHLP
FT                   HAVKKGWLRRRGGILGVVNDDYVMLTPGVLYIFEHDLARNPKVYTLSSRVLVRRLFVSV
FT                   RDQTSGGWHFGGDRYEPGPDEVDPPDAEDGLRLPSKKIDDKEKGNKKKDDKDKGGDGDP
FT                   AKSAESSKWKLREKHFFVISIPGGPMEVFASADLDDVTDWVGALRASCLGAPDRSMLAG
FT                   LKQD"
     atggcgtaca tctccgtagt gttgaacgac tggaagtaca gttgtccaat cgtctggtcg        60
     ttctacagca cagctctcgc ggcgggccgg gaaaacggca agctacggag agaggttgaa       120
     caaaacctgc gattgaagta ctccaaggag ctccccccgc cgaacacgtc gtcagagccc       180
     ccctctgaga aatctatgaa gtctggcatc aagagtggca tgaaaggggt ggcgaaaggg       240
     atgacagatg tggcgaaagt cacctccggg ggtttgactt atcttctgtt tggcgggaaa       300
     gatgatatga gcaatgagat gagggaggag ctcgaagtgg agttggacaa gatccgtcga       360
     agcagacgcg ctcgaactcg atggttcctc gcactcacct tgatgaacaa tccctcgctc       420
     atcgccatgc gcagaccgtg gggtggccag ccgcagaacg tcgcgatgct aaaaccctcc       480
     cacctccctc atgcagtcaa gaagggctgg ctgcgaaggc gaggcgggat cctcggcgtg       540
     gtgaacgatg attatgtgat gctcacgccg ggcgtactct acatcttcga gcacgacctc       600
     gccagaaacc ccaaggtgta caccctgtct tcgagggtgc tggtgcgcag gttgtttgta       660
     agcgtcaggg atcaaacctc tgggggatgg cactttggtg gtgacaggta cgagcccggg       720
     ccggacgagg ttgatccccc cgacgccgag gacggcctcc ggttgccgtc caagaaaatt       780
     gacgacaagg aaaagggcaa caagaagaag gacgacaaag acaagggggg tgatggggac       840
     cccgccaagt ctgcggaatc aagcaaatgg aagctgaggg agaagcactt cttcgtgata       900
     tccatcccgg gcgggcccat ggaggtgttc gccagcgcag acctggacga tgtgacggac       960
     tgggtcggcg ccttgcgggc gtcgtgcctg ggcgcacccg ataggtccat gctcgcgggg      1020
     ctcaagcagg actaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page