(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE300

MICSR_1.PE300        Location/Qualifiers
FT   CDS_pept        complement(598588..600120)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636930"
FT                   /orf_name="MICPUN_56877"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62169.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A657"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H7"
FT                   /transl_table=1
FT                   /translation="MAPDVSARIRAGHDASPRTPDAIKRPDGPAESSLAGPLRRAVLDD
FT                   RAAEVRALMKFRSVSENRAPDGDCTAADALLLAIERGSFASTVELVKMRATPLDAACLL
FT                   AAAASPNPECAAFVIDGCTAAGVSPDSRDHSGRTPLEIATRHRADLTAPHERSPTSHFS
FT                   PAHRHGDDGGAGAVASSLLRCGAGANVEFSDGATPLIAAARAGRHTVAAALLAHGADPL
FT                   AVDRSRSMDAVAGGTALHAAAMSGHAECVRVIVDVLRAIMEDDEASAGAFKGANGGDGH
FT                   MNCLNPFAAFSRIFSSLGPAPPSPGLKGTDWSELTGEDDEKNGGAGSSVAAPSSPVMGS
FT                   DDDDDEKDEKDGERKPSLLDAGDSIGRSALLLAIAGGNIAAASVLCDAGADRRQRVGDR
FT                   TLLHVAVERDEPEICEILLRRRDSLTPRALYRSDSFGGGGVGPFGTGVGRGALAGPPAE
FT                   VDARDSGGRTALMLAAEARKSQCAEVLADRGADQDAAPGLRRKVETLLNVYI"
     atggcgcccg acgtctccgc gcgcatccgc gccgggcacg acgcctcacc gcgcacgccc        60
     gacgcgatca agcgtccgga cggtcccgcc gagtcgtcgc tcgcgggtcc tctcaggcgc       120
     gccgtgctcg acgaccgcgc cgcggaggtg cgcgcgctca tgaagtttcg atcggtgagc       180
     gaaaatcgag ctcccgacgg cgattgcacc gccgcggacg ccctgctcct cgcgatcgag       240
     cgcggatcgt tcgcgtcgac ggtcgagctc gtcaagatgc gcgccacgcc gctcgacgcg       300
     gcgtgtctcc tcgccgcggc ggcgtcgccc aaccccgagt gcgccgcctt cgtcatcgac       360
     gggtgcaccg ccgcgggggt ctccccggac tcgagggatc actccggccg cacgcccctc       420
     gagatcgcca cgaggcaccg cgccgatctc accgcaccgc acgaacgatc cccgacgagc       480
     cacttctccc ccgcgcatcg acacggcgac gacggcggcg ccggcgccgt cgcctcgtcc       540
     ctcctgcgat gcggcgcggg cgccaacgtg gagttctccg acggtgcgac gccgctcatc       600
     gccgcggccc gcgcggggcg gcacaccgtc gccgccgcgc tcctcgcgca cggcgccgat       660
     cccctagccg tcgacagatc ccgatcgatg gacgccgtcg ccggcgggac ggcgctgcac       720
     gcggcggcga tgagcggcca cgccgagtgc gtccgcgtga tcgtcgacgt ccttcgcgcc       780
     atcatggagg acgacgaggc gtccgcgggt gccttcaagg gtgcgaacgg gggcgacggt       840
     cacatgaact gcctcaaccc gtttgcggcg ttttcgcgca tcttcagctc gctgggcccg       900
     gcgccgccgt cgccggggct caagggcacc gactggagcg agctcaccgg agaggacgat       960
     gagaagaacg gcggtgccgg aagctccgtc gcggcgccca gctcgccggt catgggcagc      1020
     gacgacgatg acgacgaaaa ggacgaaaag gatggggaac gaaaaccgag cctgctggat      1080
     gctggcgact ccatcgggag gtccgcgctc ctcctcgcga tcgcgggcgg gaacatcgcc      1140
     gcggcgtcgg tgctctgcga cgcgggcgcg gacaggcgcc agcgcgtcgg cgatcggacg      1200
     cttctccacg tggcggtgga acgggacgag cccgagattt gcgaaatctt acttcgcagg      1260
     cgggactcgc tgacgcccag ggcgctgtac cgctctgatt cgttcggagg aggaggcgtc      1320
     gggcctttcg ggacgggcgt cgggcggggg gcgctcgcgg gtccacccgc ggaggtggac      1380
     gcgagggaca gcggcgggag gaccgctctg atgctcgcgg cggaggcgag aaagtcgcag      1440
     tgcgccgagg tgctcgccga ccggggcgcc gaccaggacg ccgcgcccgg ccttcgtcgc      1500
     aaagtggaga cgctcctcaa cgtgtacatc tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page