(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE302

MICSR_1.PE302        Location/Qualifiers
FT   CDS_pept        join(complement(601933..602154),complement(601606..601755))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636932"
FT                   /orf_name="MICPUN_56879"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62170.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG734125"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniParc:UPI000199A6C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H9"
FT                   /transl_table=1
FT                   /translation="MASFVMSASAVKAPAVKVSGLGFRKAVSAVAMPKAAAKPVQAHAA
FT                   FSVVCGKPGAKAKTNKSAAKRFKITASGKVLHRRPGKQHLNGHKTTERKTRLSGERQIG
FT                   AEQIPLVKGLLPYSRKRIR"
     atggcttcct tcgtcatgtc cgcctccgcc gtcaaggctc ccgccgtcaa ggtctccggc        60
     ctcggtttcc gcaaggctgt gtccgcggtt gcgatgccca aggctgctgc caagcccgtc       120
     caggcgcacg cggcgttctc ggtggtgtgc ggcaagcccg gcgccaaggc caagaccaac       180
     aagtccgcgg ccaagcgctt caagatcacc gcttccggca aggtcctcca caggcgcccc       240
     ggcaagcagc atcttaacgg ccacaagacc accgagcgca agacccgcct cagcggcgag       300
     cgccagattg gcgccgagca gatccccctc gtgaagggtc tcctccccta ctcccgcaag       360
     aggatccgct aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page