(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE303

MICSR_1.PE303        Location/Qualifiers
FT   CDS_pept        <602704..>603614
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636933"
FT                   /orf_name="MICPUN_75681"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO61745.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199A6C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I0"
FT                   /transl_table=1
FT                   /translation="KSLVAGGVAGGVSRTAVAPLERLKILQQVAGSTTTAYNGVLRGLT
FT                   HIMRTEGMVGMFKGNGANCIRIVPNSASKFLAYETLESWLLSRARESDPNAQLGPLTRL
FT                   TAGAGAGIFAMSATYPLDMVRGRLTTQVDGKYKQYTSMTHAARVIVREEGALALYKGWL
FT                   PSVIGVIPYVGLNFAVYGTLKDVVAEWQGLKSGKDLSVPLGLACGGVAGAIGQTVAYPF
FT                   DVCRRKLQVAGWAGAKALAEGEAKHLAEMRYTGMVDCFVKTVRHEGVGALFHGLSANYV
FT                   KVAPSIAIAFVCYEEVKKLLGV"
     aagtcgctcg tcgcgggtgg ggtggcgggg ggggtctcgc gcaccgcggt cgcgccgctc        60
     gagcgcctca agattctgca gcaggtggcg gggagcacca cgaccgcgta caacggcgtg       120
     ttgagggggc tgacgcacat catgaggacc gagggaatgg tcggcatgtt caagggcaac       180
     ggcgccaact gcatccgcat cgtgcccaac tccgcgtcca agttcctcgc ctacgagacc       240
     ctcgaatcgt ggctcctctc ccgcgcgcgc gagtccgatc caaacgcgca gctcggtccc       300
     ctgacccgtc tcaccgcggg cgcgggtgcc gggatcttcg ccatgtccgc gacgtacccg       360
     ctggacatgg tccgcgggcg actcaccacg caggtggacg gcaagtacaa gcagtacacc       420
     tccatgaccc acgcggcgag ggtcatcgtg agagaagagg gcgcgctggc gctgtacaag       480
     gggtggctcc cgtccgtcat cggcgtcata ccgtacgtcg gcctgaactt cgcggtgtac       540
     ggcaccctga aggacgtcgt cgcggagtgg cagggtctca agagcgggaa ggacctctcc       600
     gttccgctcg gtctggcgtg cggcggcgtg gcgggcgcca tcggccagac ggtggcgtat       660
     cccttcgacg tgtgcaggcg gaagctgcag gtggcggggt gggcgggcgc caaggcgctc       720
     gcggagggcg aggctaaaca cctcgcggag atgaggtaca ccgggatggt ggactgcttc       780
     gtgaagacgg tgcggcacga gggagtcggc gcgctctttc atgggctgag cgccaactac       840
     gtcaaggtgg cgccgtccat cgccatcgcg tttgtgtgct acgaggaggt gaagaaacta       900
     ctgggagttg a                                                            911
//

If you have problems or comments...

PBIL Back to PBIL home page