(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE304

MICSR_1.PE304        Location/Qualifiers
FT   CDS_pept        complement(<603965..>604297)
FT                   /codon_start=1
FT                   /gene_family="HOG000240708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636934"
FT                   /orf_name="MICPUN_76741"
FT                   /product="Predicted protein"
FT                   /function="tRNA binding"
FT                   /protein_id="ACO62171.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG477532"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199A6C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I1"
FT                   /transl_table=1
FT                   /translation="DPICKARLAIGKVIEVSHVENSDKLYCCKVQVGPEEVRQVITGLR
FT                   KFVPEDDLKNRMVLTILNLKVAKLAGQTSEAMILATESETDGNLSVKLVNVPDGAVVGD
FT                   VVAAEGV"
     gaccccatct gcaaggcgcg cctcgcgatc ggcaaggtga tcgaggtgag ccacgtcgaa        60
     aactcggaca agctgtactg ctgcaaggtc caggtcggac ccgaggaggt caggcaggtc       120
     atcaccggct tgcgcaagtt cgtccccgag gacgacctga aaaaccggat ggtcctcacc       180
     atcctcaacc tcaaggtggc caagctcgcg ggtcagacct cggaggccat gatcctcgcc       240
     accgagtcgg aaaccgacgg aaacctcagc gtcaagctcg tcaacgtccc cgacggagcc       300
     gtcgtcggcg acgtcgtcgc cgcggagggc gtc                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page