(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE305

MICSR_1.PE305        Location/Qualifiers
FT   CDS_pept        complement(604839..606470)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636935"
FT                   /orf_name="MICPUN_56882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62172.1"
FT                   /db_xref="UniParc:UPI000199A6C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I2"
FT                   /transl_table=1
FT                   /translation="MPEKDGSWLLGVVVCSKTGTCLVNACSDAPLRVRELCRMLPALHS
FT                   LAAGVASPTSHLDLSTCSVALCESRVGYIVAALTSPGADWRQRRTSASFVAETVSRAFA
FT                   WHGGEHLESFIARDMDDAVMDATFDAGEDADDGDDDDATTHPQFRSFELEFLRPALARE
FT                   FARPAHVRWLEPLVGCVTARVAHAHVLIPRSRDDDASHGSGHRPATNDDVAAAVRDDRE
FT                   FDDSALSDAVRTKELGARATWECHVVASARGTEASHPLARLCDVDAVGCGEIWRETRER
FT                   CLAMAESRARRCAATAEVGGTFDGDGVGLSGHRRVSSRVKGAGVVRGAFAKREASTPPE
FT                   TAVLVFRNVGGGGGKKDGDVGRDRRTLRAVIHAFSCHPGSAIGTACAVAFCVSPPVGDS
FT                   PGGDSPGGDSPGSPTGRGWPDDLDGWDPPEVSGGYVSRRVAGGTGATSSVMPTDLARAM
FT                   FRVADAVRTTLDPHFDWSNHRSSSDGATEAKKRWGGLDGTGLEEGHTERSGRGDGVPAV
FT                   GKDAGWVVVKGAGPPTGRGVRRVVPA"
     atgcccgaga aggacggatc ctggctcctc ggcgtggtcg tctgctccaa gacgggcacg        60
     tgcctggtca acgcgtgttc ggatgcaccc ctccgggttc gagagctgtg ccgcatgctg       120
     cccgcgctcc actccctcgc cgcgggcgtc gcatccccca cgtcacacct cgacctctcc       180
     acctgctccg tcgcgctgtg cgagagcagg gtggggtaca tcgtcgcggc gttgacctcg       240
     ccgggcgccg actggcgaca acgacgaacg agcgcctcgt tcgtcgccga gacggtatcg       300
     cgcgccttcg cgtggcacgg cggcgaacac ctcgagtctt tcatcgcccg agacatggac       360
     gacgcggtga tggacgcgac gtttgacgcg ggtgaagacg cagacgacgg agacgacgac       420
     gacgcgacga cgcatccgca gtttcgaagc ttcgagctcg agttcctccg gcccgcgctc       480
     gcccgcgagt tcgcgcggcc cgcgcacgtt cggtggctcg agcccctcgt gggatgcgtc       540
     accgcgcggg tggcgcacgc gcacgtgctg ataccccgct cccgcgacga tgacgcatcc       600
     cacgggagcg gccatcgccc cgcgacgaac gacgacgtcg ccgcggcggt cagggacgat       660
     cgcgaattcg acgattcggc tttgtcggac gcggttcgga caaaggaact gggcgcgcgc       720
     gcgacgtggg agtgtcacgt cgtggcgtcc gcgcggggaa ccgaggcgtc gcacccgctc       780
     gcgaggctgt gcgacgtcga cgcggtgggg tgcggcgaga tttggcggga gacgcgggag       840
     cggtgtttgg cgatggccga gtcgagggcg cggcggtgcg cggcgacggc cgaggtcggg       900
     ggtacgtttg acggcgacgg cgtcggcttg agcggtcacc gacgagtcag ttcgcgggtg       960
     aagggcgccg gggtggttcg gggcgcgttc gcgaaaaggg aggcgtccac gccgccggag      1020
     acggccgtgc tcgtgttcag gaatgtcggg ggagggggag ggaaaaagga cggggacgtg      1080
     ggtcgggatc ggcggacgct gcgagcggtt atacacgcgt tctcgtgcca cccgggctcg      1140
     gcgatcggta cggcgtgcgc ggtggcgttt tgcgtgtcgc cgccggtggg tgactcaccg      1200
     ggcggtgact caccgggcgg tgactcgccg ggctccccga cggggcgcgg gtggccggac      1260
     gatttagacg gatgggaccc gccggaagta tccggaggat acgtgtccag gcgcgtggcg      1320
     ggcggcaccg gcgccacctc gagcgtcatg ccgaccgatc tcgccagggc gatgttccgg      1380
     gtcgccgacg cggtgaggac gacgctcgac ccgcatttcg attggagcaa ccatcgttcg      1440
     tcgtcggatg gggcgacgga ggcgaagaaa cggtgggggg ggctcgacgg taccggtctt      1500
     gaagagggtc acacggaacg gtcgggacgg ggcgacggtg tccccgccgt tggtaaagac      1560
     gcggggtggg tggtggtgaa aggcgcgggt ccaccgacgg gtcggggcgt gaggagggtc      1620
     gttccggcgt ag                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page