(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE307

MICSR_1.PE307        Location/Qualifiers
FT   CDS_pept        complement(608056..610962)
FT                   /codon_start=1
FT                   /gene_family="HOG000205991" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636937"
FT                   /orf_name="MICPUN_104770"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ACO62173.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG284496"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015930"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI000199A6C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I4"
FT                   /transl_table=1
FT                   /translation="MMRKAVNGRALRRLLERAAPATSSTAGSRGFASTARTTGAIAAPL
FT                   ARRAPLASRAPAPPRAGSLLPAASLASIARSARSASTFLAEYDAHVAERAAQNIAPKPL
FT                   DAKQVAALCEQLESPPAGDEAVLMDLFENRVPPGVDEAAYVKASWLAAIVEGKARSPLV
FT                   DAAKAVRILGTMQGGYNIAPLVQALDDPALGPLAADQLTGTLLVFDAFHDVEAKAKAGN
FT                   EHATRVMRSWADAEWFTRRPPVPEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAL
FT                   AMLKNPRDGIHDAPAQIEELKTKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVP
FT                   NKRTGGVCVGGKIAPIFFNTMEDSGALPLEMDVTNMNMGDVVEIYPYQGVAKRHGSGEE
FT                   LCRFSLKTDVLLDEVQAGGRINLIIGRGLTSRARESLGLPASDVFRLPSNPPGSGSKGF
FT                   TLAQKMVGKACGVDGGILPGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSSDLVMQ
FT                   SFCHTAAYPKPVDVVTHHTLPDFIRNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSH
FT                   TRFPIGISFPAGSGLVAFGAATGVIPLDMPESVLVRFKGTMQPGITLRDLVHAIPYYAI
FT                   KEGHLTVAKQGKKNIFSGRILEIEGLSHLKCEQAFELSDASAERSAAGCTIKLDKEPIA
FT                   EYLRSNIIMLKWMIDQGYGDRRTLERRIAGMEAWLADPKLLEADPDAEYAAVIEIDMDQ
FT                   IKEPILCAPNDPDDARLLSEVTGDKVDEVFIGSCMTNIGHFRAAGKLLKEFDGQLPTRL
FT                   WVAPPTKMDEAQLTAEGYYSVYGSVGARTEMPGCSLCMGNQARVAEKSTVVSTSTRNFP
FT                   NRLGKGANVYLASAELAAVSAILGRLPTPAEYLEYAGKLDATASDTYRYLNFDELPQYV
FT                   ESADKVTMEDEAYAGLGPAMREQLLKVAREKKAAKAAA"
     atgatgcgaa aggccgtgaa cggccgcgcg ctgcgccgcc tcctggagcg cgccgctccg        60
     gcgacctcat ccaccgccgg ctcgagaggt ttcgcctcga cggcgaggac gacgggagcg       120
     atcgcggctc cgctcgcgcg ccgcgcgccg ctcgcctccc gcgcgcccgc gccgccccgc       180
     gccggatccc tcctccccgc cgcgtccctc gcctccatcg cgcgatccgc cagatccgcc       240
     tccaccttcc tcgccgagta cgacgcgcac gtcgccgagc gcgcggcgca gaacatcgcg       300
     cccaagcccc tcgacgcgaa gcaggtcgcc gcgctctgcg agcagctcga gtcgcccccc       360
     gcgggcgacg aggccgttct catggacctc ttcgagaacc gcgtcccgcc gggcgtcgac       420
     gaggccgcct acgtcaaggc atcgtggctc gcggcgatcg tggagggcaa agcgagatcg       480
     cccctcgtgg acgcggccaa ggctgtgcgc atcttgggca ccatgcaggg cggctacaac       540
     atcgcgcccc tggttcaggc gctcgacgac ccggcgctcg gacccctcgc cgcggaccag       600
     ctcaccggca ccctcctcgt cttcgacgcc ttccacgacg tcgaggccaa ggccaaggct       660
     ggcaacgaac acgcgacccg ggtgatgcgt tcgtgggccg acgccgagtg gttcacccgc       720
     cgacccccgg tgcccgagaa gatcaccgtg accgtgttca aggtgacggg cgagaccaac       780
     acggacgacc tgtccccggc gcccgacgcg tggtcccgac cggacatccc cctccacgcg       840
     ctcgccatgc tcaagaaccc gagggacggc atccacgacg cgccggcgca gattgaggag       900
     ctcaagacga agggcttccc gctggcgtac gtcggggacg tcgtcggcac cggttccagc       960
     cgcaaatccg cgaccaactc cgtgctctgg ttcatgggcg acgacatccc gaacgtcccg      1020
     aacaagcgca cgggcggggt gtgcgtcggc ggaaaaatcg cgcccatctt tttcaacacg      1080
     atggaagatt ccggagcgct gccgctggag atggacgtga ccaacatgaa catgggcgac      1140
     gtcgtcgaga tttacccgta ccagggcgtc gccaagaggc acggcagcgg cgaggagctc      1200
     tgcaggttct cgctcaagac ggacgtcctc ctcgacgagg tgcaggcggg cgggcgcatc      1260
     aacctcatca tcggccgcgg gctcaccagc agggcgaggg agagcctcgg ccttcccgcc      1320
     tccgacgtct tcaggctccc gtccaacccc cccggctcgg gttccaaggg gttcacgctc      1380
     gcgcagaaga tggtgggcaa ggcgtgcggc gtcgacggcg gcatcctccc cggcacctac      1440
     tgcgagccca agatgaccac cgtgggatcc caggacacca ccgggccgat gaccagggac      1500
     gagctgaaag atctcgcgtg cctcggcttc tcgtccgacc tagtgatgca gtcgttctgt      1560
     cacaccgcgg cgtaccccaa gcccgtggac gtggtgacgc atcacaccct gccggatttc      1620
     atccgcaacc gcggcggcgt gagcctccga ccgggcgacg gggtgatcca ctcgtggctc      1680
     aacaggatgc tgctgccgga cactgtcggc acggggggcg attctcacac gcgcttcccc      1740
     atcggaatct cgttcccggc gggctccggc ctcgtcgcct tcggcgcggc gaccggcgtg      1800
     attcccctgg acatgcccga gtccgtgctc gtgcgcttta agggtacgat gcagcccggc      1860
     atcacgctcc gcgacttggt ccacgcgatc ccttactacg cgattaagga ggggcacctc      1920
     accgtcgcaa agcagggcaa gaagaacatc ttctccggtc gcatcctcga gatcgagggt      1980
     ctctcccacc tcaagtgtga gcaagccttc gagctctccg acgcttccgc ggagagatcc      2040
     gccgccggtt gcaccatcaa gctcgacaag gagcccatcg cggagtacct ccgttctaac      2100
     atcatcatgc tcaagtggat gatcgaccag ggctacggcg acaggcgcac cctcgagcgt      2160
     cgcatcgcgg gcatggaggc ttggctcgcg gaccccaagc tcctcgaggc ggaccccgac      2220
     gccgaatacg ccgcggtcat cgagatcgac atggatcaga tcaaggagcc catcctctgc      2280
     gctcccaacg accctgacga cgcccggctc ctctccgagg tgactgggga caaagtcgac      2340
     gaggtcttca tcggctcgtg catgaccaac atcgggcact tccgcgccgc gggcaagctg      2400
     ctgaaggagt tcgacgggca gctcccgacc aggctgtggg tcgcgccccc gacgaagatg      2460
     gacgaggcgc agctcaccgc ggaggggtac tactccgtct acggctccgt cggcgcgagg      2520
     accgagatgc cgggctgctc tctctgcatg ggcaaccagg ccagggtcgc ggagaaatcc      2580
     accgtcgtct ccacgtccac caggaacttc cccaacaggc tcggcaaggg cgcgaacgtg      2640
     tacctggcgt ccgccgagct cgcggcggtc tccgccatcc tcggcaggct gcccacgccc      2700
     gccgagtacc tcgagtacgc tggtaagctc gacgccaccg cttcggacac ctacaggtac      2760
     ctcaactttg acgagctgcc ccagtacgtg gagagcgccg ataaggtgac gatggaggac      2820
     gaggcctacg ccggcttggg tcccgcgatg cgagagcagc tgttgaaggt tgcgagggag      2880
     aagaaggcgg ccaaggctgc ggcgtga                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page