(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE308

MICSR_1.PE308        Location/Qualifiers
FT   CDS_pept        611512..612834
FT                   /codon_start=1
FT                   /gene_family="HOG000264470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636938"
FT                   /orf_name="MICPUN_56885"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61747.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560126"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199A6C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I5"
FT                   /transl_table=1
FT                   /translation="MFAVAPILGAGAVGLGRARTLPTSTRISTSPRSTNRVATVVRAAR
FT                   KGSPQSAQGRKKMSKGKIAKKNQEFIEQDTEKDAQIEAMRKAAAASRASVDEGEQASSM
FT                   PPGKLDGMSFEDKLKAVKEEGAAKRQQMAEAEAPRKLMDEMLTGKAPVMRSSIYDDAPA
FT                   KPGGITFAQAGGKTPDDELNVFVKIGAGLLSLGLLVVFIPSDFVFSTNVSSAPQGELSP
FT                   EIVEQVKKQASIYEEALASTPEDVDKLRGAAESYVVLEDYTAAIPLLKRLLEIQPSVEN
FT                   VGNLADVYAANGSLAKAAEVYRDAVNAEWSGASLKPPALVKGLVDALDKDGRYGLSLEY
FT                   VKKFREKGQVDDVDGALLEARVYSGWKGHSKEAEKAYQDVIDTHGDDFRGYLAKGVFYR
FT                   EIGKPDAAEGMFRQAKALVPGEMREVANAVIAQAKAQGALQ"
     atgttcgcgg tcgctcccat cctcggcgcg ggcgcggtcg gcctcggccg cgcgcgaacg        60
     ctccccacgt ccacgcggat atcgacgtcg ccccgctcca ccaatcgggt cgcgacggtc       120
     gttcgcgccg cgcgcaaggg ctcgccccag agcgcgcagg gccgcaagaa gatgagcaag       180
     ggcaagatcg cgaagaagaa ccaggagttc atcgagcaag acaccgagaa ggacgcgcag       240
     atcgaggcca tgcggaaggc ggccgcggcg tcccgcgcga gcgtcgacga gggcgaacaa       300
     gcatcctcga tgcctcccgg aaagctcgac ggcatgagct tcgaggataa gctcaaggcg       360
     gtcaaggagg agggcgccgc gaagcgccaa cagatggccg aggccgaggc accccgcaag       420
     ctcatggacg agatgctcac cggcaaggcg cccgtcatgc gctcctccat ctacgacgac       480
     gcgccagcca agccgggcgg gatcacgttt gcgcaggctg ggggcaagac cccggatgac       540
     gagctcaacg tcttcgtcaa gatcggcgcg ggtctcctct ccctcggcct cctcgtcgtc       600
     ttcatcccgt ccgatttcgt gttcagcacg aacgtctcga gcgcgccaca gggggagcta       660
     tcccccgaga tcgtcgagca ggtcaagaaa caggcttcca tctacgagga agcgctggcg       720
     tccactcccg aggacgtcga caagctccgg ggcgccgccg agtcgtacgt cgtgctggag       780
     gactacaccg ccgccatacc gctgctcaag cggctgctgg agatccagcc gagcgtggag       840
     aacgtgggaa acctcgcgga cgtgtacgcc gccaacgggt cactcgcgaa agccgccgag       900
     gtgtatcgcg acgccgtcaa cgcggagtgg tcgggggcga gcctgaagcc gcccgcgctc       960
     gtcaagggcc tggtggacgc gctggacaag gacgggcggt acggcctgag cctcgagtac      1020
     gttaagaagt ttcgggagaa ggggcaggtg gacgacgtgg acggcgcgct cttggaggcg      1080
     agggtgtaca gcgggtggaa agggcactcc aaagaagcgg agaaggcgta ccaggacgtc      1140
     atcgacacac acggcgacga cttcaggggg tacctggcga aaggggtgtt ctacagggag      1200
     atcggcaagc cggacgccgc ggaggggatg tttcggcagg ccaaggcgct ggtgccgggt      1260
     gagatgaggg aggttgcgaa cgcggtcatc gcgcaggcga aggcgcaggg cgcgctgcaa      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page