(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE31

MICSR_1.PE31         Location/Qualifiers
FT   CDS_pept        56429..57250
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636036"
FT                   /orf_name="MICPUN_107851"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61599.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q8"
FT                   /transl_table=1
FT                   /translation="MRGSFADLVAVPSSQLATKPPSLTHAEAAALVLPGLTVVQALRQH
FT                   GFGPGTRVLVLGASGGVGHLAVQVASARGAQLVVGVCSGRNVEFVKSMGADDVLDYEAL
FT                   EPPDDDEAGVAPDPLVEALREVLRKHGGRPFDLVLDTVSSHDARDRAHAYKSRIRSNPA
FT                   LLDDSPNAADKHNYVTIGGRTGGWITAGVKRVTGVNLFKRGKELFWINFNQCAPDLRTL
FT                   RALAEGEGSNGGVRAVKPAIERTVPLTDEGVREAFRALHGRRVRGKLAIEL"
     atgcgcggtt ccttcgccga tctcgtcgcc gtcccgtcgt cgcagctcgc cacgaaaccc        60
     ccgtcgctga cgcacgcgga agccgccgcg ctcgtgctcc ccggcctcac cgtcgtgcag       120
     gcgctgcgtc agcacgggtt cgggccgggc acgagggtgt tggtgctcgg cgcctcgggc       180
     ggggtcggtc acctcgccgt gcaggtcgcg tcggcgaggg gcgcacagct ggtcgtcggc       240
     gtgtgcagcg gccgaaacgt cgaattcgtc aaatccatgg gcgccgacga cgtcctcgac       300
     tacgaggcgc tcgaaccccc ggacgacgac gaggcggggg tagcgccgga tccgctggtg       360
     gaggcactgc gtgaggtatt gcgcaaacac ggcggccgcc ctttcgacct ggtgctggac       420
     accgtctcga gccacgacgc gagggatcgg gcgcacgcgt acaagtcgcg gatccgatcg       480
     aacccggcgt tgctcgacga ttcgccgaac gccgccgaca agcacaacta cgtgacgatc       540
     gggggtagga ctggcgggtg gatcaccgcg ggggtgaagc gggtgacggg tgtcaacttg       600
     ttcaagcggg gcaaggagct gttctggatc aactttaacc agtgcgcgcc ggacctgaga       660
     acgctcaggg cgctggcgga aggggaaggt tcgaacggag gggttcgcgc ggtgaagccg       720
     gcgatcgaga ggacggttcc cctgacggac gagggagtgc gcgaggcgtt cagggcgctg       780
     cacgggagga gggtcagggg gaagctcgcg atcgagcttt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page