(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE310

MICSR_1.PE310        Location/Qualifiers
FT   CDS_pept        join(complement(614732..614983),complement(614513..614698),
FT                   complement(613643..614428))
FT                   /codon_start=1
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636940"
FT                   /gene_name="PEX12"
FT                   /orf_name="MICPUN_80117"
FT                   /product="Peroxisomal protein importer family "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="ACO62174.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560128"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A6CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I7"
FT                   /transl_table=1
FT                   /translation="MQFQVDAGDSRPTFFELVATDRLVPSLRAALVYSLRTLAERRPGV
FT                   TRILDHEAEAFALLMLLVEAHSFATSDGSLAEGLYGLQRRGGRGGRGGRAAVARGGLLR
FT                   SGDDDGGNGARRSRRIGGKQRLLSVLVLVGLPYAREKLDALYPPGRSSRDEGARDGDDD
FT                   DARGGRRARGGSSPTPAAPSSSSSASAVSGASVRAGAAAAFVSAYPWIHAGWEAVVFWC
FT                   WLRYLLKDGTTHDPSLATLRLAVVRASPSEVTARRARVESARASRVNRLSSSPSWMTRV
FT                   VGPTALRAGHFALDHAQGGLMAAVVGFKLLEWWYGSAEDAVFRDRSHPPPPPPPRTAPH
FT                   PRARCVVPRDPALCPLCRRRCSQPAVVRTSGWVFCHPCVVDEVRRFGRCPVTLAAAAEG
FT                   DVVRLFSE"
     atgcagttcc aggtggacgc gggcgactcc cgcccgacgt tcttcgagct cgtcgcgacg        60
     gaccggctcg tgccgtcgct tcgcgcggcg ctggtgtact cgctgaggac gctcgcggag       120
     aggcgaccgg gggtgacgcg gatcctcgac cacgaggcgg aggcgttcgc gctcctcatg       180
     ctcctcgtcg aggcgcactc cttcgcgacg tccgacggga gcctggcgga gggcctgtac       240
     ggactgcagc gccgcggagg gcgcggaggg cgtggagggc gcgcggcggt cgcccggggc       300
     ggactcctcc gttcgggcga cgacgacggc gggaacggcg cgcgccgatc gcggaggatc       360
     ggcgggaagc agcgactgct ctccgtgctc gtgctcgtgg gactgccgta cgcgcgagag       420
     aagctggacg cgctgtaccc gccggggcga tcgtcgagag acgagggagc ccgggacggc       480
     gacgacgacg acgcgcgcgg gggacgtcgc gcgcgcgggg gttcatcgcc gacgccggct       540
     gcgccgtcgt cgtcgtcgtc ggcgtcggcc gtctcggggg cgtccgttcg agccggcgcc       600
     gccgccgcgt ttgtctccgc gtatccgtgg atccacgcgg gctgggaggc cgtcgtgttc       660
     tggtgctggc tccggtacct cctcaaagac ggcaccacgc acgatccctc gctggcgacg       720
     ctccggctgg ccgtcgtccg cgcgtcgccg tcggaggtga ccgctcgcag agcgcgagtc       780
     gaatccgctc gcgcgtcgag ggtcaatcgc ctgtcgtcgt cgccgtcgtg gatgacgcgc       840
     gtggtggggc cgacggcgtt gagggcgggt cacttcgccc tggaccacgc gcagggcggt       900
     ttgatggcgg cggtcgtcgg gttcaagctc ctggagtggt ggtacggctc ggcggaggat       960
     gcggtgtttc gcgatcgatc gcacccgccg ccgccgccgc cgccgaggac ggcgccgcac      1020
     cctcgcgcac ggtgcgtcgt gccgcgggac cccgcgctgt gcccgctgtg ccggcggcgg      1080
     tgttcccagc ccgcggtggt gcgcacgagc gggtgggtgt tctgtcaccc gtgcgtcgtg      1140
     gacgaggttc gtcgattcgg gcggtgcccg gtgacgctcg cggcggcggc ggagggcgac      1200
     gtcgtgcgcc tgttcagcga gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page