(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE311

MICSR_1.PE311        Location/Qualifiers
FT   CDS_pept        join(615284..616504,616637..618490)
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636941"
FT                   /orf_name="MICPUN_79480"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61749.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199A6CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I8"
FT                   /transl_table=1
FT                   /translation="MEDLVNDPHAEEIVVRENYGRDGAAEIGAIARGLRLHFRQYGKGT
FT                   NTALVASKVPLPDYRADLDGRRRAEHEVDMSPDTMAIVARALHDSPSVEDLSANLGSLT
FT                   HASQSKRQRGDGDRSRSRVDEASHLLRRDAAVDAAAQKAELERLESPHVAARMAQRARL
FT                   PAFERRDELLAAVDACTNVLVVSGETGCGKTTQLPQFVLERALASGDASVTGILCTQPR
FT                   RISAISVAARVAQERGEELGESVGYQIRLEARRSAATRLLFCTTGVLLRRLAVEPTLDS
FT                   VSHVFVDEIHERGMNEDFLLVVLRDLLPRRPDLKIVLMSATLDAGLFAAYFGGAPVAHI
FT                   PGFTYNVRTLFLEDALEAFGTRLVVSPPDARRDGFGGFGGKRRGRFGGGRREPTPGYNP
FT                   DEDEDGGDNLVATLVATCDPADPDGDGAILVFLTGWDEITKVNDLMRADPLLGDRTKCA
FT                   VLPLHGAMPTANQREIFDRPPRGVRKIILSTNIAETSITIDDVTHVVDCGKSKEKTYDA
FT                   LNNLACLQPAWISKASAHQRRGRAGRVREGVCYRLYTKAQHAKMADHATPELLRTPLEE
FT                   LCLTIKSLGLGLCEPFIARALQPPEPKSVHNAIELLITIGALSRRTEELTPLGRHLAAL
FT                   PVDPRVGKMLVTAATFGCLSPALTIAAGMAYKDPFVLPMDKKHQADAVRRRLAGDTRSD
FT                   HIALVRAFEGWTRARRDGGNREGWEYCRRNFLSGNTLELMSDMRRQFADLLHGIGFLPD
FT                   GARSADRVDAAHNRHAADVAMLRAVICAGMYPRLVSVRPRGRRNELKTHEDGKVECHPS
FT                   SVNSEFGVSFPFPWLVYCEKVKTSGVYIRDSTCVPAYAVLLLGGDLDEEPDGTAGDGDD
FT                   DVGIRVCGGHYTFSAPRDVLALVRKLRREIDSLLDAKARNPGLGGFGCGFVDAMRALVA
FT                   DEEHRAYGGDDRGRDRGGGGGDRGGGWGRRGGRGGFGGAPGTSGGDWECSNGCGLVFGG
FT                   KRSCFRCGAPREGDRGDGGRGGLGGGPPAPRHVRF"
     atggaggacc tcgtgaacga cccgcacgcc gaggagatcg tcgtgcgcga gaactacggc        60
     cgcgacggcg cggcagagat cggggcgatc gcgcgcggcc tgaggctgca cttcaggcag       120
     tacggcaagg gcaccaacac cgccctcgtc gcgtccaagg tgcctctgcc ggactacagg       180
     gcggacctcg acggccgacg gcgcgcggag cacgaggtgg acatgtcgcc ggataccatg       240
     gcgatcgtcg cgagggcgtt gcacgactcc ccgagcgtcg aggacctgag cgcgaacctc       300
     gggagtctca cgcacgcctc gcaatcgaag cggcaacgcg gcgacggcga ccgatcccga       360
     agtcgcgtcg acgaggcgtc ccatctttta cgcagggacg cagccgtgga cgccgccgcc       420
     caaaaggccg agctcgaacg actcgaatcc ccgcacgtcg ccgcgcgcat ggcccaacgc       480
     gcgaggctcc cggcgttcga gagacgagac gagctgctcg cggcggtgga cgcgtgtacg       540
     aacgtgctgg tggtatccgg cgagacgggc tgcggcaaaa caacgcaact gccgcagttt       600
     gtcctcgaac gcgcgctggc gagcggcgac gcgtcggtga cgggcatcct gtgcacgcaa       660
     ccgcggcgca tctccgcgat atccgtcgcc gcgcgagtgg cgcaggagag gggcgaggag       720
     ctcggcgagt ccgtcgggta tcagatccgg ttggaagctc ggcggtccgc ggcgacccgg       780
     ctattattct gcaccaccgg cgtgctcctc cgcaggctcg ccgtggaacc cacgctggac       840
     agcgtgtcgc acgtgttcgt ggacgagatt cacgagcgcg gcatgaacga ggacttcctc       900
     ctcgtggtgc tcagggacct gctgccgcgt cgaccggatt tgaaaatcgt gctaatgtcg       960
     gcgacgctgg atgcgggact cttcgcggcg tacttcggcg gcgcgcccgt cgcgcacatt      1020
     ccggggttca cctacaatgt gcgaacgctg ttcctggagg atgcgttgga ggcgttcggg      1080
     acgcggttgg tcgtgtcgcc gcctgacgcg aggagggacg ggttcggcgg gtttggtggg      1140
     aagcgacggg gtcggttcgg cggcggccgc cgggaaccga cgcccggata taaccccgac      1200
     gaggacgagg acggcggcga caatttggtc gccacattgg tcgccacatg tgacccggca      1260
     gaccccgacg gcgacggcgc gatcctcgtc ttcctcaccg gctgggacga gatcaccaag      1320
     gttaacgacc tgatgcgcgc ggaccctctg ttgggggacc ggaccaagtg cgcggttctg      1380
     ccgcttcacg gcgcgatgcc cacggcgaac caacgggaaa tcttcgacag gcccccgcgc      1440
     ggcgttcgca agatcatcct ctccaccaac atcgccgaga cgtccatcac gatcgacgac      1500
     gtcacgcacg tcgtcgactg cggcaagagc aaggagaaga cgtacgacgc tttgaacaac      1560
     ctcgcgtgtt tgcagccggc ttggatttcg aaggcgtcgg cgcatcaacg ccggggccga      1620
     gccggtcgag tccgcgaggg ggtttgctac cgtctgtaca ccaaggcgca gcacgcgaag      1680
     atggcggacc acgccacccc cgagctgctc cgaaccccgc tggaggagct gtgcctgacg      1740
     atcaagtcgt tgggtttggg tttgtgcgag ccgttcatcg cgagggcgct tcaaccgccc      1800
     gagccaaagt cggttcataa cgcgatcgag ctgttgatca ccatcggagc cctgtcgcgt      1860
     cgcaccgagg agctcacgcc cctgggcagg cacctcgccg cgcttcccgt ggacccgagg      1920
     gttggcaaga tgctggtcac ggccgcgacg ttcggatgct tatccccggc gctgaccatc      1980
     gcggcgggca tggcgtacaa ggacccgttt gtattgccca tggacaagaa gcaccaagcg      2040
     gacgccgttc gcaggcgtct cgcgggggac acgcgcagcg atcacatcgc cctcgtccgc      2100
     gcgttcgagg ggtggacgcg cgcgcgccgg gacggcggca acagggaggg atgggagtac      2160
     tgccgccgta actttctcag cggaaacacc ctggagctca tgtccgacat gcgtcggcag      2220
     ttcgccgacc tgctgcacgg gatcggattc ctccccgacg gcgcgagatc cgcggatcgc      2280
     gtcgacgctg cccacaacag gcacgccgcg gacgtcgcca tgctccgcgc ggtgatatgc      2340
     gccgggatgt acccgcgact cgtctccgtc cgaccccggg gccgacgcaa cgagctcaag      2400
     acacacgagg acggcaaggt ggagtgccac ccgagctcgg tcaactccga gtttggcgtc      2460
     tcgttcccgt tcccgtggct ggtgtactgc gagaaggtca agacgagcgg ggtgtacatc      2520
     cgagacagca cctgcgtccc cgcgtacgcg gtgctgctgc tgggcggcga cctggacgag      2580
     gagccagacg gcacagccgg cgacggcgac gacgacgtgg ggattcgggt gtgcggcggg      2640
     cactacacgt tcagcgcgcc gcgcgacgtc ctcgcgctcg tccgaaagct ccgccgcgag      2700
     atcgactcgt tgctcgacgc caaggcgagg aacccggggc ttggcggctt cgggtgcggc      2760
     ttcgtggacg cgatgcgcgc gctcgtggcg gacgaggagc acagggcgta cggcggggat      2820
     gatcggggaa gggatcgggg cggcgggggc ggggatcggg gcggcggctg gggtcgtcga      2880
     ggcggccgcg ggggtttcgg cggtgcaccg ggaacgagcg ggggcgactg ggagtgttcc      2940
     aacgggtgcg gtttggtgtt tggcgggaag aggagttgct tcaggtgcgg ggcgccgagg      3000
     gagggcgacc gcggggacgg ggggcgggga gggctcgggg gcggtccgcc cgcgccgagg      3060
     cacgtgcggt tttag                                                       3075
//

If you have problems or comments...

PBIL Back to PBIL home page