(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE312

MICSR_1.PE312        Location/Qualifiers
FT   CDS_pept        join(complement(619272..619457),complement(618864..619010))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636942"
FT                   /orf_name="MICPUN_56889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62175.1"
FT                   /db_xref="UniParc:UPI000199A6CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I9"
FT                   /transl_table=1
FT                   /translation="MSGLDEYDYLIYPGFMRRPMARWNEDGSVAPMARARGPKGEAFQL
FT                   TLKQSEIDEDIAHIEYEIGIGKKPKKKRTGPPLNPKLEAVKKQEEEERVASESEREEQD
FT                   GDSDKK"
     atgtcgggac tggacgaata cgactacctg atatacccgg gcttcatgcg tcgccccatg        60
     gcgcgctgga acgaggacgg cagcgtcgcg ccgatggccc gcgcgcgcgg gcccaagggg       120
     gaggctttcc agctcacgct caagcaatcg gagattgacg aagacatcgc gcacatagag       180
     tacgagattg ggatcgggaa gaagcccaag aagaagagga ccggtccccc gttgaacccg       240
     aagctggaag ccgtgaagaa acaggaggag gaggagaggg tggcgtcgga gagcgagagg       300
     gaggagcagg acggggattc ggacaagaaa tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page