(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE314

MICSR_1.PE314        Location/Qualifiers
FT   CDS_pept        <619880..>620776
FT                   /codon_start=1
FT                   /gene_family="HOG000157237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636944"
FT                   /orf_name="MICPUN_70956"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61750.1"
FT                   /db_xref="HOGENOM:HBG709927"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199A6CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J1"
FT                   /transl_table=1
FT                   /translation="ETTVVSAEWLKANIGRPDVVVLDCSWYLPAMERDPRAEHEAKRVP
FT                   GARFFDVDGVSDPSSPLPHMLPDAGAFAAACDAVGVANGDQVVVYDGAGLFSAARGWWM
FT                   FKVFGHDAVALLDGGMRAWEKLDGATVETKPPAVPIAAATDACARWYDDASKPSSTPSS
FT                   SFRATLRPELVLRRDDVLARCVGAAATETLVDARPKPRWAGEAPEPRAGIRSGRVPGSA
FT                   CVPFFDVLDADDRTFKSRDEIRDVFSAAGADVTGAKKVVASCGTGVTACVLSLGAAIAR
FT                   GDGTPLPVYDGSWTEWGA"
     gagaccaccg tcgtgagcgc cgagtggctg aaggccaaca tcgggaggcc cgacgtcgtg        60
     gtcctcgact gcagctggta cctccccgcg atggagcgcg acccacgcgc ggagcacgag       120
     gccaagcgcg tcccgggcgc caggttcttc gacgtcgatg gagtgtccga tccgtcctcg       180
     cctctgcccc acatgctccc ggacgcgggc gcgttcgccg cggcgtgcga cgccgtgggc       240
     gtcgccaacg gcgatcaggt tgtcgtgtac gacggcgcgg gtctcttcag cgcggcgcgg       300
     ggctggtgga tgttcaaggt cttcggccac gacgccgtcg cgctcctgga cggcgggatg       360
     cgcgcgtggg agaaactcga cggcgcgacg gttgagacga aaccccctgc cgtcccaatc       420
     gccgccgcca cggacgcctg cgcgaggtgg tacgacgacg cctcgaagcc gtcgtcgacg       480
     ccgtcgtcgt cgttccgcgc gacgctcagg cccgagctgg tgctgcgcag ggacgatgtg       540
     ctcgcgcggt gcgtcggcgc ggcggcgacg gagactttgg tggatgcgcg acccaagccg       600
     agatgggccg gcgaggctcc cgagccccgc gcggggatcc ggagcggtcg cgtgccgggc       660
     agcgcgtgcg tcccgttctt cgacgtcctc gacgcggacg atcggacgtt caagtcccgt       720
     gacgagattc gcgacgtctt ctccgccgcg ggcgcggacg tgacgggtgc gaagaaagtc       780
     gtggcgagct gcggcaccgg cgtcaccgcg tgcgtgctgt cgctcggggc ggcgatcgcg       840
     cggggggacg ggacgccgct tccggtgtac gacgggtcgt ggacggagtg gggcgcg          897
//

If you have problems or comments...

PBIL Back to PBIL home page