(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE315

MICSR_1.PE315        Location/Qualifiers
FT   CDS_pept        complement(620909..622051)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636945"
FT                   /orf_name="MICPUN_56892"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62177.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG608966"
FT                   /db_xref="InterPro:IPR010675"
FT                   /db_xref="UniParc:UPI000199A6D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J2"
FT                   /transl_table=1
FT                   /translation="MEEAPGAEEAPEAAPASRAATKKRSREDRDAAGASNPPSGLDAWA
FT                   EEATANRGGAGAASSAGGDGRGGGDAAPASHVKFGGANGGGRDANGRQRQCFRYGNYHR
FT                   YYGYRVGESLEDHRIAHLKREWFHRKRCVDVGCNEGLVSLSIAVSFGSTTMLGIDIDEW
FT                   LVKKAREKLRRMRRAAAKAATKAERESEEAARMAAEASAREADAAAGGTLRSHPATRVA
FT                   AATETTDGTGEVGSQLGAKLADSGPSLGGVTFRASNILDETFEPGSVDAFLCLSVTKWI
FT                   QLNWGDAGLKKMFKQIYDALSPGGVFIVEPQPWKSYKQAFRKQKMPEETREHFRGIELR
FT                   PAFFAEHLRQVVGFSSVQAIRSADLHVADEFDRNLLLCVK"
     atggaagaag ccccgggggc ggaggaagcg ccggaggcgg cgccggcctc ccgcgccgcg        60
     acgaagaagc gctcgcgcga agaccgcgac gccgccggcg catcgaaccc cccgtcgggc       120
     ctggacgcgt gggcggagga ggcgacggcg aacaggggag gggccggggc ggcatcgtcg       180
     gcggggggcg acggtcgcgg cgggggcgac gccgcgcccg cctcccacgt caagttcggc       240
     ggcgcgaacg gcggcggccg ggacgcgaac ggtcgacagc gtcagtgctt caggtacggc       300
     aactaccacc gctactacgg ctaccgcgtg ggggagtcgc tcgaggacca tcgcatcgcg       360
     cacttgaagc gcgagtggtt ccatcgcaag aggtgcgtcg acgtcgggtg caacgagggg       420
     ctggtgtcgc tgtccatcgc ggtctcgttc ggatccacca ccatgttggg catcgacatc       480
     gacgagtggc tcgtgaagaa ggcgcgggag aagctgcggc ggatgcgacg cgcggccgcg       540
     aaggcggcga cgaaagcgga gcgagaatcg gaggaggcgg cgaggatggc ggctgaagcg       600
     tcggcaagag aggcggacgc ggcggcgggc gggaccctca ggtcgcaccc ggcgacgcgc       660
     gtggcggcgg cgacggagac gacggacgga acgggcgagg ttggatctca attgggggct       720
     aaattggcgg actccggtcc gtcgctcggc ggcgtcacct ttcgcgcgag taacatcctc       780
     gacgagacgt tcgagccggg ttcggtggac gccttcctgt gcctgtccgt gacgaagtgg       840
     atccagctga actggggcga cgcgggcctg aagaagatgt tcaaacagat ctacgacgcg       900
     ctgtctcccg ggggggtgtt catcgtggag ccgcagccgt ggaagagtta caagcaggcg       960
     tttaggaagc agaagatgcc ggaggagacc cgcgagcact tccggggcat tgagctgcgc      1020
     ccggcgttct tcgcggagca cctgaggcag gtcgtcggct tctcgtcggt gcaggcgata      1080
     cggtcggcgg acctgcacgt cgcggacgag ttcgacagaa acttgctcct gtgcgtcaag      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page