(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE316

MICSR_1.PE316        Location/Qualifiers
FT   CDS_pept        622478..624277
FT                   /codon_start=1
FT                   /gene_family="HOG000264576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636946"
FT                   /orf_name="MICPUN_56893"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61751.1"
FT                   /db_xref="HOGENOM:HBG560131"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199A748"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J3"
FT                   /transl_table=1
FT                   /translation="MSFRKGLVEIWEDMMSYRTLKVVKISDKRLAYVHKSLMASILVYA
FT                   TITMVGAHTYMLKEKPRLYVTTTVDDTNRLSNWTLDSTSGPRGYCNSAYTSFPGDEFVP
FT                   EPAYPQTRCASYISTAQMVSVTDQGAFIGTHMRQQAWKRTCTDETTKLDCVVENKDENG
FT                   AAVDAEDHFAADIENIVLKLQPIYVTSWGVSEPAHRITVVNAAGQEVKEFERYGTDSTS
FT                   QWPTFTLKELLKLAEMDIDAQNPIIVSKNFKGLDAETGQPRLPLYRLTGLRIAVDFTFS
FT                   NFRPMGQMKPFDFTPLAVMTVKATSVGSFVTPRESTIYSGTTSNFDSQGTTLSIRGVKI
FT                   EYQAKGLMGKADGYTGMMALMSCLVMVGVATAIVDVIGAFIYDSFKDDKIEDDSERQHL
FT                   EHMILNIETSGVPFKNDDFEFEPGTSVKKQIDELTRDIQRQATLLHHMSGELAAAGLNS
FT                   HTMHMADLGEGVQSARYECVLKGPNGEDIFLTGGPQTVGRGHGGTQSKRISHKQISVVA
FT                   NTHNGMARVQGLPTKNISGVALGGGPWQPLGPEASVDLKNGDMIALLMDEGADEAETTV
FT                   DGVFRFQATYVEDKQQGGSWFGW"
     atgtcgttca gaaaaggttt agtcgagatt tgggaggaca tgatgtccta ccgtaccctc        60
     aaggtggtga agatcagcga caagaggctg gcgtacgtgc acaagagtct catggcgtcc       120
     atcctcgtct acgccaccat caccatggtt ggcgcgcaca catacatgct caaggagaag       180
     ccgaggctct acgtgaccac gacggtggac gacacgaatc ggctaagtaa ttggacgcta       240
     gatagtacgt cggggccgag ggggtactgt aactcggcgt acacgtcgtt ccccggcgac       300
     gagttcgtgc ccgagccggc gtacccgcaa acgcggtgcg cgagttacat cagcaccgcg       360
     cagatggtct cggtgacgga ccagggcgcg ttcatcggaa cgcacatgcg acaacaggcg       420
     tggaaacgca cgtgcacgga cgagacgacg aagctggact gcgtggtgga gaacaaggac       480
     gagaacggcg ccgcggttga cgcggaggac cacttcgcgg cggacattga gaacatcgtg       540
     ctgaagctcc agcccatcta cgtcacgtcc tggggggtgt ccgaaccggc gcacaggatc       600
     acggtggtga acgccgcggg gcaggaagtc aaggagttcg aaaggtacgg caccgactcc       660
     accagccagt ggccgacttt cacgttgaag gaactcctaa agctggcgga gatggacatc       720
     gacgcgcaga atccgatcat cgtctccaaa aatttcaaag ggttggacgc ggagactggg       780
     cagccgcggc tgccgctgta ccggctcacc ggcctgcgca tcgccgtgga cttcacgttc       840
     agcaacttca ggccgatggg gcagatgaaa cccttcgact tcaccccgtt ggccgtcatg       900
     accgtcaagg cgaccagcgt cgggtcgttt gtcacgccgc gagagtccac catctactcg       960
     ggcaccacca gtaacttcga ctcgcagggc accacgttat cgatccgcgg cgtgaagatc      1020
     gagtaccagg cgaagggcct gatgggtaag gcggatgggt acaccggcat gatggcgctc      1080
     atgtcttgcc tcgtcatggt gggcgtggcg acggcgattg tggacgtcat cggcgccttc      1140
     atctacgact cgttcaagga tgacaagatc gaggacgact ccgagcgtca gcacctggag      1200
     cacatgatcc tcaacatcga aacttcgggc gtgcccttca agaacgacga cttcgagttc      1260
     gagccgggca cgagcgtcaa gaaacagatc gacgagttga cgagggacat ccagcggcag      1320
     gcgacgctgc tgcaccacat gtccggggag ctcgcggcgg cgggtctcaa cagccacacc      1380
     atgcacatgg cggacctcgg cgagggggtg cagagcgcga ggtatgagtg cgtcctcaag      1440
     ggacccaacg gcgaggacat cttcctcacc ggcggaccgc agacggtggg acgcgggcac      1500
     ggcggcacgc agtccaagcg catctcgcac aagcagatca gcgtcgtcgc caacacgcac      1560
     aacggcatgg cgcgagtgca gggtttaccg accaagaaca tctccggcgt ggcgctcggc      1620
     ggcggaccgt ggcagccgct cggtcccgag gcgagcgtgg acctgaagaa cggggacatg      1680
     atcgcgctgc tcatggacga gggcgcggat gaggcggaga ccaccgtcga cggcgtgttc      1740
     aggtttcagg cgacgtacgt cgaggacaag cagcaggggg gctcgtggtt cgggtggtga      1800
//

If you have problems or comments...

PBIL Back to PBIL home page