(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE317

MICSR_1.PE317        Location/Qualifiers
FT   CDS_pept        624694..626592
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636947"
FT                   /orf_name="MICPUN_56894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61752.1"
FT                   /db_xref="UniParc:UPI000199A749"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J4"
FT                   /transl_table=1
FT                   /translation="MRPSIARDPGGGSRFPAPRVRPKSARRSRERSFRFRGRSNPASAP
FT                   RRCPPPPSRAPFRPINSPALSPRPPSSDQHHFPITTRRARGDGWSWNWDAPKPERNPAG
FT                   SRGPGLSVTGGRDAASDVDGRQVGGSQRGQLRLGPAGGRTSIPNRGPGAAPGRVGDGHG
FT                   YPRAGAAAAAAAANDLRGYVPAYGLGADLGGMNLDDINDTAGATAYVDDDDLDSPEQHQ
FT                   THDVIITEIEEINLTDYMQTLQAPTFSEEALATADFGFGGDRTFSGSGLYGAGMNGFDA
FT                   AASPKQGAGGVMGGSDKFPMRSETPGRAGRRVWSRGGNRSTDAGSGGLATATPGIDRPQ
FT                   TGGLDEADVNRPLHTHGLDDDEDGGDPEVDADIFDDSDDDSWGEETHAVDTFGGNQNGA
FT                   DVLSDDEDGGHAASPKAMGAVNPSFGGSAIAARSPGAGGGAGGSFSGFVSGGGASLPGR
FT                   QSPLPGSSSSSSSSFAASREARRRREEEGDFVVMSTPSGLRRVPSARRRPGTGGGGGGG
FT                   ARPGGGGGGGWPSGAGFKDGSGGGKAEVVADVYGAKENASIPPRGASAGGLGLLQRPPS
FT                   RQRPPPEATNLFARRAAAAAAAAAAPVVPGLNKVSRPAGMASNMMFSHRPGQTGGW"
     atgcgtccgt ccatcgcgcg ggaccccggc ggcggttcga ggttcccggc gccgcgcgtg        60
     cgtccgaaat ccgcgcggcg ctctcgcgaa cggtcgttcc gtttccgcgg acgttcgaac       120
     cctgcgtccg cgccgcgccg ctgccccccg cccccgtctc gcgcgccgtt ccgtccaatc       180
     aattcgcccg cgctttcgcc ccgcccgcct tcgtctgatc aacaccattt tccgataaca       240
     acgcgcaggg ccaggggcga cggatggagc tggaactggg acgccccaaa gcccgagagg       300
     aaccccgcgg gctcgcgcgg ccccggcctc agcgtcaccg gcgggcgcga cgccgcatcg       360
     gacgtggacg gacgccaggt tggcggatcg cagcgcgggc agctccgcct cgggcccgcg       420
     ggaggacgaa cctccatccc gaaccgcggc cccggcgccg ccccgggacg cgtcggcgac       480
     ggacacgggt acccccgcgc gggtgccgcc gccgccgcgg cggcggcgaa cgacctgcgc       540
     gggtacgtcc cggcgtacgg actcggcgcg gacctcgggg gcatgaacct ggacgatata       600
     aacgacacag ctggcgcgac cgcgtacgtc gacgacgacg acctcgactc ccccgagcag       660
     caccagacgc acgacgtcat catcaccgag atcgaggaga tcaacctgac ggactacatg       720
     cagacgttac aggcgcccac gttcagcgag gaggcgttgg ccaccgcgga ttttgggttc       780
     ggcggcgatc ggactttcag cggatctgga ttgtacggcg ccgggatgaa cgggtttgac       840
     gccgcggcga gcccgaagca aggcgccggt ggggtgatgg gcggttcgga taagtttccg       900
     atgaggtccg agacccccgg gcgagccggt cggagggtgt ggtcgcgggg cgggaaccga       960
     tcgacggacg cgggttcggg aggattggcg acggcgacgc cggggatcga tcgaccgcag      1020
     acgggcggcc tggacgaggc ggacgtcaac aggccccttc acacgcacgg gttggacgac      1080
     gacgaggacg gcggggatcc ggaggtggac gccgacatct tcgacgactc cgacgacgat      1140
     tcgtggggcg aggagaccca cgcggttgac accttcgggg gtaaccaaaa cggcgccgac      1200
     gtcctcagcg acgacgaaga cgggggccac gcggcttccc cgaaggccat gggcgcggtc      1260
     aacccgtcgt tcgggggttc cgccatcgca gcgaggtccc cgggcgcggg aggaggagcg      1320
     ggggggtcgt tttcgggttt cgtcagcggc ggcggcgcgt cgctgccggg gaggcaatcg      1380
     ccgcttccgg gatcttcttc ttcttcttct tcttcattcg cggcgtcgcg ggaggcgcgg      1440
     cgacgtcgcg aggaggaggg tgacttcgtc gtcatgtcca cgccgtccgg tttgcgacgc      1500
     gtgccgtccg cgaggcgcag gcccggaacc ggcgggggcg gcggcggggg cgcgaggccc      1560
     ggcggcggcg gcggcggggg atggccgtct ggagccggtt tcaaggacgg ctcgggcggc      1620
     ggcaaggcgg aggttgtcgc ggacgtgtac ggggcgaagg agaacgcctc gatcccgccg      1680
     aggggggcga gcgcaggcgg gttggggttg ctgcagcggc cgccgagcag gcagcggccg      1740
     ccgccggagg cgaccaatct cttcgcgagg agggcggcgg ctgcggctgc ggctgcggcg      1800
     gcgccggttg tgcccgggct gaacaaggtt tcgaggcccg cggggatggc gtcgaacatg      1860
     atgttctcgc accgaccggg tcagactggg ggatggtga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page