(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE318

MICSR_1.PE318        Location/Qualifiers
FT   CDS_pept        complement(626801..627634)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636948"
FT                   /orf_name="MICPUN_56895"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62178.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199A74A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J5"
FT                   /transl_table=1
FT                   /translation="MRTHAFRLGAVLFLALATTGAFAGDCTGLLNCNDCASIAAISNHK
FT                   CLNGGTCNAAYASSDDKVCICPSSTEGVECQTPGVTRCAGGSWCGNNGECGTNFRCKCT
FT                   VGFTGNRCEESQPPDNCVIPSNHQCLNGGKCTNNTNTPCNCPPNVGGPSCEKVDVRVCV
FT                   DGTYCENGGDCKVSGGCACDEGFIGATCGEVDREWFQARYNSGGGSSSSKKEVVNVAAA
FT                   VAVPLVLIIAAGGGFMAYMVHKERKGAPLFSKIDDVPDVEMSARNALPAPAVAKA"
     atgaggacgc acgccttccg cctaggcgcc gtcctattcc tcgccctggc gacgacaggg        60
     gcgttcgcgg gggattgcac cggcttgttg aactgcaacg actgcgcgag catcgccgcc       120
     atcagcaacc ataaatgcct caacggtggc acgtgcaacg ccgcctacgc ctcctcggac       180
     gacaaagtct gcatctgccc gagcagtacc gaaggggtcg agtgccagac ccccggcgtc       240
     actcgatgcg ctggcggaag ttggtgtggc aacaacggag agtgcggcac caactttcgc       300
     tgcaagtgca ccgtcggatt cacgggcaat cgttgcgagg aatcgcagcc cccggacaac       360
     tgcgtcatcc ccagcaacca ccagtgcctc aacggcggca agtgcaccaa caacaccaac       420
     acgccgtgca actgcccgcc caacgtcggt ggaccgagct gcgagaaggt cgacgtgcgc       480
     gtctgcgtcg acgggaccta ctgcgagaac ggcggcgatt gcaaagtctc cggaggatgc       540
     gcgtgcgacg agggattcat cggcgccacc tgcggcgagg tggatcgcga gtggttccag       600
     gcgagataca actccggcgg cgggtcctcc agcagcaaga aggaggtcgt caacgtcgcg       660
     gccgcggttg ccgtgcccct ggtgctcatc atcgcggcgg gcggcggctt catggcgtac       720
     atggtgcaca aggagcgcaa gggtgcgccg ctcttctcca agattgacga cgtcccggac       780
     gtggagatga gcgcgcggaa cgccctccct gcgcccgcgg tcgccaaggc gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page