(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE32

MICSR_1.PE32         Location/Qualifiers
FT   CDS_pept        58152..58379
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636037"
FT                   /orf_name="MICPUN_79671"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61600.1"
FT                   /db_xref="UniParc:UPI000199AB28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q9"
FT                   /transl_table=1
FT                   /translation="MALARTWGDELTLRACSDAFQCVIHVVQSTAENWYLVYEPQTEEG
FT                   DGRESRRRKRLFLTYVSPVHYNSFTREGDN"
     atggcgttgg cgagaacgtg gggagacgag ctcaccctac gggcgtgctc cgacgcgttc        60
     cagtgcgtca tacacgtggt gcagtccacg gcggagaact ggtacctggt gtacgagccg       120
     cagaccgaag agggggacgg gcgggagtcg cggcggcgaa agcgtctctt cctgacgtac       180
     gtgtcgcccg tgcactacaa ctcgttcacg cgcgaggggg ataactga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page