(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE321

MICSR_1.PE321        Location/Qualifiers
FT   CDS_pept        join(629589..629651,629765..631954)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636951"
FT                   /orf_name="MICPUN_56898"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO61754.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199A74D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J8"
FT                   /transl_table=1
FT                   /translation="MGDDVVNVFADEFEHPPGETLDILRDESIVKTVVEPAPAGGFKTR
FT                   PSVGDQVSFTVRRVHAANAPTAGTVAQDAELERYLLGCGAQCRAVEVALETMREGEVAT
FT                   FLCKERHLPAPNIESVYPEEVTIRLAKIFRDVDLTPRPSPGGKLIKRRTRWGDAKTHGQ
FT                   TLYEPMTLSHSPRPGYGSDTGRDVARPGCRVIVYTKHKPTAVNANTGLDAEPWTPMEFT
FT                   LRSTAVDAPPCPDGVHEALELSLTLASPGERFEVTFPASVYGFADDRVDGTVESDAVAS
FT                   ARFAETYDTGGDLVTTEVHVRAVHPPAPFAPEHAGPGGWGGTKDVGLDGEDLWTMPKWE
FT                   RAHRAKAAKERGVALFKAGRHRAALRAYDVAIRLLTAPFAPLDLSKVEMPEWDPPSEQD
FT                   PLGKDPHLKLAERYGSNAWRGLADSGLGEGNENQVLLKATILNASLAASRRGDHATCEW
FT                   YCSKALAEDPMCVKGWFRRGRARVAMHRWDEAEDDLNRAERLQGDDEIAKELDVERKKL
FT                   AAGRKKSESGGAVAKAFRAVFGGGGGGAGEYPKPREMRRLVTGDLGIEAGPAHPTGRLD
FT                   TDEPGAQLDELLDETSPHTRMEHAFNKALHYEQIGLNEFVDSGMPIELYSEAELAPVGE
FT                   GHPTAQAVEKREYVVPFGEAEAAELDAEIAEREHDEELYDKMLNAAKRGNRVQRGTATH
FT                   NPWDRDGTKAVDELNMQFVKEYNEQKMEEAKEEMEAHKKQWHERKKRATGDDIALD"
     atgggcgatg acgtcgtgaa cgtcttcgcg gacgagttcg agcatccacc cggggagacc        60
     ttggacatcc tccgggacga atcgatcgtc aagaccgtgg tggagcccgc gcccgccggc       120
     gggttcaaga cgcgcccgtc cgtcggcgac caggtgtcat tcaccgtccg tcgcgtccac       180
     gccgcgaacg cgccgaccgc gggcacggtg gcgcaggatg ccgagctcga gaggtacctc       240
     ctcggctgcg gcgcgcagtg cagggcggtg gaggttgcgc tggagaccat gcgcgagggc       300
     gaggtggcca cgttcctgtg caaggagcgc cacctgcccg cgccaaacat cgagagcgtc       360
     taccccgagg aggtcaccat ccgactggcc aagatcttcc gcgacgtcga cctgacgccg       420
     cgaccgagcc cgggtggcaa actcatcaag cgcaggacgc gttggggaga cgcgaagacc       480
     cacggacaga cgctctacga gcccatgacc ctgtcccact cgccgcggcc ggggtacggc       540
     tcggacaccg ggcgggacgt cgctcgaccc ggctgtcgcg tcatagtgta cacgaaacat       600
     aaaccgacag ctgtgaacgc aaacacggga ctggacgccg aaccctggac gccgatggag       660
     tttaccctgc gaagcaccgc ggtggacgcg cccccgtgcc ccgacggcgt gcacgaggcg       720
     ctcgagctgt cgctaacgct ggcctcgccc ggggagaggt tcgaggtgac gtttccggca       780
     tccgtgtacg gcttcgccga cgatcgcgtc gacgggacgg tcgagtcgga cgcggtcgcg       840
     agtgcgcggt tcgccgaaac gtacgacacc ggcggcgatc tcgtgaccac ggaggttcac       900
     gtcagggcgg tgcacccgcc ggcgccgttc gcgcccgagc acgcggggcc cgggggatgg       960
     ggcggcacga aggacgtcgg gttggacggc gaggatctct ggacgatgcc caaatgggag      1020
     cgggcgcacc gagctaaggc ggcgaaggag cgaggggtgg cgctgttcaa ggcggggcgg      1080
     cacagggccg ctctgagggc gtacgacgtc gcgatccgtc tcctcaccgc gcccttcgcg      1140
     cccctggatc tctcaaaggt ggagatgccc gagtgggatc cgccgagcga gcaagacccg      1200
     ctcggaaaag acccgcactt gaaactcgcg gaacgttacg gctccaacgc gtggcggggt      1260
     ttggcggact ccgggcttgg cgagggcaac gagaaccagg tcttgctcaa ggcgacgatc      1320
     ctcaacgcca gcttggccgc gtccaggcgc ggtgaccacg cgacgtgcga gtggtactgc      1380
     agcaaggctc tcgccgagga tcccatgtgc gtgaagggtt ggttccgcag gggccgagcc      1440
     agggtcgcga tgcatcggtg ggacgaggcg gaggacgatt tgaaccgcgc ggagaggctc      1500
     cagggcgacg acgagatcgc gaaggagctg gatgtggagc gtaagaagct ggcggcgggg      1560
     cggaagaaga gcgagagcgg cggcgccgtc gcgaaagcgt tcagagcggt ctttggcggc      1620
     ggcggcggcg gcgccggaga gtacccgaaa ccgcgagaga tgcggcggct ggtcaccggc      1680
     gacctgggca tcgaggcggg tcccgcgcac cccaccggga ggctggacac cgacgaaccg      1740
     ggcgcacagc tggacgagct tctcgacgag acgtcgccgc acacgcgcat ggagcacgcg      1800
     ttcaacaagg cgctgcacta cgagcaaatc ggcctgaacg aattcgtcga ctcgggcatg      1860
     cccatcgagc tgtactcgga agccgagctc gcgcccgtgg gcgagggcca tcccaccgcc      1920
     caggccgtgg agaagaggga gtacgtcgtc ccgttcggcg aggccgaagc cgcggagctc      1980
     gacgcggaga ttgcggaacg cgagcacgac gaggagctct acgacaaaat gctcaacgcc      2040
     gcgaagaggg gtaaccgcgt gcagaggggc acggcgacgc acaacccgtg ggaccgcgac      2100
     gggaccaagg cggtggacga gctcaacatg cagttcgtca aggagtacaa cgagcagaag      2160
     atggaggagg ccaaggagga gatggaggct cacaagaagc agtggcacga acggaagaag      2220
     agggcgacgg gggacgacat cgcgttggac tga                                   2253
//

If you have problems or comments...

PBIL Back to PBIL home page