(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE322

MICSR_1.PE322        Location/Qualifiers
FT   CDS_pept        join(complement(632692..632772),complement(632468..632539))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636952"
FT                   /orf_name="MICPUN_56899"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62180.1"
FT                   /db_xref="UniParc:UPI000199A74E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J9"
FT                   /transl_table=1
FT                   /translation="MAEADDDKKWYSKPNKRESLWGLGGMAIASSVAGIIYLVKREKDE
FT                   KVDKK"
     atggccgaag cagacgacga caagaagtgg tacagcaagc ccaacaagcg agagtcgctg        60
     tggggcctgg gaggcatggc gatcgcctcc tccgtcgccg gcatcatcta cctcgtcaag       120
     agggagaagg acgagaaggt ggacaagaag tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page