(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE323

MICSR_1.PE323        Location/Qualifiers
FT   CDS_pept        633364..633537
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636953"
FT                   /orf_name="MICPUN_107904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61755.1"
FT                   /db_xref="UniParc:UPI000199A74F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K0"
FT                   /transl_table=1
FT                   /translation="MDAMGPVVVNEDGSLSRIANWPMLTDREKEVTQRRIAKRNKERLD
FT                   RLREAAKENERA"
     atggacgcca tgggaccggt ggtggtgaac gaggacggtt cgctgtccag gatcgccaac        60
     tggccgatgc tcacggacag ggaaaaagag gtgacgcagc gaaggatagc caagcgcaac       120
     aaggaacgac tggacagact cagggaggcg gccaaggaga acgagcgcgc gtga             174
//

If you have problems or comments...

PBIL Back to PBIL home page