(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE324

MICSR_1.PE324        Location/Qualifiers
FT   CDS_pept        complement(633625..636048)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636954"
FT                   /orf_name="MICPUN_56901"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62181.1"
FT                   /db_xref="UniParc:UPI000199A750"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K1"
FT                   /transl_table=1
FT                   /translation="MVQRRAHPLPPRLLLLVVALLPALASAAAPTSVNPLAAVAESPSL
FT                   PRELVARVRASGAELAAGGLAPLAAAAVDARGGGDALARTLASTRAAVLALCGSAAVLE
FT                   RSADDTTPRADEAGDPAPAPPALLEDAENLAALFHWLAVELDAALAVAPDAPASPTARR
FT                   EGGTWSLADELREARAVLAARLETSSSSPSSSSSTSSSSNSGFSCYRWSGYIARSLAAR
FT                   NALSLPFDELVEATSTWSDAELDACGLRHARLAFLATEINERETADDAGGGNDSRNEHL
FT                   VHGLNLTAFGAVVETCRVGGGNGLAQLVGPGAFAAAATRLARLKSHLSAMDTALRSQTA
FT                   IDGFRCLSDASLAPAMDDEADAPPGSRLATATAILSFLAGAAEDVLVADRGCERARESS
FT                   STGAYYPVPVFDRIAQELAQCGVGDAYGRAWLRARYPNGGTAGLASRLDQVAAAVDACS
FT                   EGSSLNREDVKAARSKTPPLTRVDLDALAATIRHFRSADAAMFGCRRGAYAHSAAGALA
FT                   HALDGYRAVLASCPAATADSTGSDPTEIVHPEIVHPSSSSYVVIPVTEAAARGEGVKGR
FT                   GRFEPGGGAGFVGVVSASCVLAVGGVAFCVARYLQTRRDRSVRGPWRKMDAAGGDLGRP
FT                   PRVPPSGPGPGGRAPFAFSARRFYRHLQAGSVGDLPLVEDLDRASGVSTESEGNDRVDT
FT                   PPLRMGNVVDLPSPRTNRRSNSISEPATRPPPAVTPDDLVLRGFAGGISEPKPRHPSRH
FT                   STPYHGLRSVGELRVNIPVGAFRETADGRRPTTPPAGASGAAPFFGGEKRLTHP"
     atggtgcagc ggcgagcgca cccccttccc ccccgcctcc tcctcctcgt cgtcgcgctc        60
     ctccccgcgc tcgcgtccgc cgccgccccg acgtcggtta accccctcgc cgccgtcgct       120
     gagagcccct cgctgccccg cgagctcgtc gcgagggtcc gcgcgtcggg cgcggagctc       180
     gcggcgggtg ggctggcgcc cctcgccgcc gccgcggtgg acgcgcgcgg gggcggcgac       240
     gcgctcgcgc ggaccctcgc ctcgacgcgc gcggcggtgc tcgccctctg cgggtccgcg       300
     gcggtgctcg agcggagcgc cgacgacacc acgccgcgcg ccgacgaggc cggagacccg       360
     gcccccgccc cgcccgccct cctcgaggac gccgaaaacc tcgcggcgct gttccactgg       420
     ctcgcggtgg aactcgacgc cgccctcgcc gtcgcgcccg acgcgcccgc gtcgccgacg       480
     gcgcgacgcg agggcggaac gtggtccctc gcggacgaac ttcgagaggc gcgcgccgtc       540
     cttgccgcgc gactcgaaac ctcctcctcc tccccctcct cctcctcctc aacctcctca       600
     tcctcaaact cggggttttc gtgctaccgt tggagcgggt acatcgcgag gagcctggcg       660
     gcgaggaacg cgctctcgct tcccttcgac gaactcgtgg aggcgacgtc gacgtggtcg       720
     gacgcggagc tcgacgcgtg cggactgcga cacgcgcgcc tcgcttttct cgcgacggaa       780
     ataaacgaga gggagacagc cgacgacgcc gggggaggaa acgacagccg gaatgaacac       840
     ctcgtgcacg gcctcaacct cacggcgttc ggcgcggtcg tcgagacgtg ccgcgtcggg       900
     ggcgggaacg ggctcgcgca gctcgtgggc ccgggcgcgt tcgccgcggc agcgacccgg       960
     ctcgctcggc ttaaatcgca cctctccgcg atggacacgg cgctgcgaag ccaaaccgcg      1020
     atcgacgggt ttagatgcct gagcgacgcg tcgctggcac ccgcgatgga cgacgaggcc      1080
     gacgccccgc ccggctccag actcgccacc gccaccgcga tactttcctt cctcgcggga      1140
     gccgccgagg acgtcctcgt cgccgatcgc gggtgcgagc gagctcgcga atcgtcctcg      1200
     acgggcgcgt actatcccgt gcctgttttc gacaggatcg cgcaggagct cgcgcagtgc      1260
     ggcgtagggg acgcgtacgg ccgcgcgtgg ctccgggcga ggtacccgaa cgggggcacc      1320
     gccggactgg cgtcgaggct cgaccaggtg gcagccgcgg tggacgcgtg cagcgagggt      1380
     tcgtctttga atcgcgaaga cgtcaaagcc gctcggtcaa agacgccgcc cctcaccagg      1440
     gtcgatctcg acgcgctcgc cgcgacgatt cgtcacttcc gatcggcgga cgcggcgatg      1500
     ttcgggtgca gacgcggcgc gtacgcgcac agcgccgcgg gggcactcgc gcacgccctc      1560
     gacggctacc gcgcggtcct cgcctcctgc ccggcggcga cggcggattc gaccggctca      1620
     gacccgactg agattgtcca ccccgagatc gtccacccgt cgtcgtcgtc gtacgtggtc      1680
     atccccgtga ccgaggcggc ggcacgaggc gagggagtca aaggacgcgg gaggttcgag      1740
     ccggggggcg gcgctggttt cgtcggtgtg gtgtcggctt cgtgcgtcct cgccgtcggc      1800
     ggggtcgcgt tttgcgtcgc gcggtacctc caaacgaggc gcgatcgatc cgtccgcggg      1860
     ccttggcgaa agatggatgc cgccggcggc gacctcgggc gtcccccgcg agtgccgccg      1920
     tccggtcccg gtcccggcgg ccgcgctccg ttcgcgttct ccgccagacg gttctaccgg      1980
     caccttcagg cgggtagcgt gggcgacctc ccgctcgtcg aggacctgga ccgcgcgtcc      2040
     ggagtttcca ccgaatccga gggcaacgat cgcgtcgaca cgcccccgtt gaggatgggc      2100
     aacgtcgtgg acctgcccag cccgcggacc aaccgccgca gcaactccat ctccgagccc      2160
     gccacgcggc cgccccccgc ggttacgccc gacgatttgg tcctcagggg tttcgccggg      2220
     ggcatcagcg agccgaagcc ccggcacccg tcgcggcact ccaccccgta ccacggcctg      2280
     cggagcgttg gggagctccg ggtgaacata ccggtcgggg cgtttcggga gacggcggac      2340
     ggccggcggc cgaccacgcc gccggcgggc gcatccggcg ctgctccgtt ctttggcggt      2400
     gagaagcggc tgacgcaccc gtga                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page