(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE325

MICSR_1.PE325        Location/Qualifiers
FT   CDS_pept        join(complement(637691..637729),complement(636263..637396))
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636955"
FT                   /orf_name="MICPUN_90239"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62182.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199A751"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K2"
FT                   /transl_table=1
FT                   /translation="MDGPTDAEKLPVTIVTGFLGAGKTTLVNHILKGDHGKLIAVIENE
FT                   FGAVSIDDALVGENIKEQENIITMDNGCVCCTVRGDLVRALLTLKDKTKKFDHVIIETT
FT                   GLADPAPVAFTFFINPEIADHYRIDSILCLADAKHIGLHLEEEKPDGAVNEAVQQVAFA
FT                   DRILLNKIDLVSDTELAAVMEQVRSINGVAEVIKTTNSVVDLDKVLGVSSFSIEKTLEV
FT                   DPDFLEDEEGHAAATAAHDGAAADGGDHGHGHSHDGGKTECHEDHGHGHGHGEPAAKKP
FT                   RKKRHDLTGVSSVGILAEGELDFNQVNTFMMTVLQENAKSIYRSKGVLCFKDQGNTKFV
FT                   FQGVHEHINFGPSSVEWGADEPRVNRMVFIGRNLNRKELEEGFRACLVKD"
     atggacggac ccaccgatgc cgagaagctc cccgtcacga tcgtgacggg tttcctgggc        60
     gcgggcaaga ccacgctggt gaaccacatc ctcaagggcg accacggtaa gctcatcgcc       120
     gtcatcgaga acgagttcgg cgccgtctcc atcgacgacg ccctcgtcgg cgagaacatc       180
     aaggagcagg agaacatcat caccatggac aacgggtgcg tgtgctgcac cgtccgcggc       240
     gatctcgtcc gagcgctgct tacgctcaag gacaagacca agaagttcga ccacgtcatc       300
     atcgagacca ccggcctcgc cgatcccgcg cccgtcgcgt tcaccttctt catcaacccc       360
     gagatcgcgg atcactaccg catcgactcc atcctctgcc tcgccgacgc taagcacatc       420
     ggcctgcacc tcgaggagga gaagcccgac ggcgccgtca acgaggcggt gcagcaggtg       480
     gccttcgccg accgcatcct gctcaacaag atcgatctcg tgtccgacac cgagctcgcg       540
     gcggtgatgg aacaggtgcg gtccatcaac ggcgtggcgg aggtgatcaa gaccaccaac       600
     tccgtcgtcg acctcgacaa ggtcctcggg gtttcctcgt tttccatcga gaagaccctg       660
     gaggtggacc cggatttctt ggaggacgag gaaggacacg cggcggccac cgcggcgcac       720
     gacggcgccg cggccgacgg cggcgaccac ggccacggcc actcgcacga cggcggcaag       780
     acggaatgcc acgaggatca cggccacggc cacggccacg gcgagcccgc cgcgaagaag       840
     ccgcgcaaga agaggcacga cctcaccggc gtgtcctccg tcggtatcct cgcggagggc       900
     gagctcgact tcaaccaggt caacaccttc atgatgacgg tgctccagga gaacgccaag       960
     agcatctacc gcagcaaggg tgtgctgtgc ttcaaggacc aggggaacac caagtttgtg      1020
     ttccagggcg ttcacgagca catcaacttc ggaccctcgt cggtggagtg gggcgccgac      1080
     gagccgaggg tgaacaggat ggtgttcatc ggacggaacc tgaaccgcaa ggagctggag      1140
     gagggcttca gggcctgcct cgtcaaggac tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page