(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE327

MICSR_1.PE327        Location/Qualifiers
FT   CDS_pept        complement(639847..640569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636957"
FT                   /orf_name="MICPUN_107906"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62183.1"
FT                   /db_xref="UniParc:UPI000199A753"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K4"
FT                   /transl_table=1
FT                   /translation="MSDGYAAAQARKEAYLASLILQDVEKRGEAVRERGVTAWAHRPRE
FT                   REQVNERFLRNTLRGVDSSNRRVEQQAVRSGSPAPGAGGAKRVRPEDVVVDHGRGGAGS
FT                   TRRGSEGTSSSSSSAAASSSDSEPDAKPSAGNGKGGMRDDELAEFLSRPRVKRGRGAVG
FT                   SRADEPGPFLPGGGAEHKVGGYSLVLANEETRRNDARIAAMRDEAKRKERKKAEKREKK
FT                   ERKRERKEGRSEKKKRRR"
     atgtccgacg ggtatgccgc cgcgcaggcc cgtaaggagg cgtatctcgc gtcgctcatc        60
     ctccaggacg tggagaagcg cggcgaggcg gtgcgcgagc gcggcgtcac cgcgtgggcg       120
     catcgcccga gggagcgcga gcaggtgaac gagcgcttcc tgcggaacac gctgcgaggg       180
     gtggactcga gcaacaggcg cgtggagcaa caggcggtgc ggtcgggtag ccccgcgccg       240
     ggagccggtg gcgccaagcg agtgcgtccg gaggacgtcg tcgtggacca cgggcgcgga       300
     ggcgcgggat ctacccgccg ggggtcggaa ggcacctcct catcctcatc ctccgcggcg       360
     gcgtcctctt ccgactccga gccggatgcg aagccgagcg cggggaatgg gaagggcggg       420
     atgagggacg atgagctcgc cgagtttctc tccaggccgc gggtcaagcg cggcaggggc       480
     gccgtgggct ccagagcgga cgaacccggc ccttttctcc ccggaggagg cgcggagcac       540
     aaggtggggg ggtactctct cgtgttggcg aatgaggaga cgcggcgaaa cgacgcgagg       600
     atcgcggcga tgcgggacga ggcgaaacgg aaggagcgga agaaggcgga gaagagggag       660
     aagaaggagc gcaagaggga gcgaaaggag ggcaggtccg agaagaagaa gcgacggcgg       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page