(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE328

MICSR_1.PE328        Location/Qualifiers
FT   CDS_pept        641175..642533
FT                   /codon_start=1
FT                   /gene_family="HOG000264352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636958"
FT                   /orf_name="MICPUN_56905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61757.1"
FT                   /db_xref="HOGENOM:HBG560142"
FT                   /db_xref="UniParc:UPI000199A754"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K5"
FT                   /transl_table=1
FT                   /translation="MARGTGPSRRSNRPSSRALGNSALNTRGIARGERGTRGKSSRVAS
FT                   RATSNEDDEPPAPEPLLVIVEVDGVLCDVHCDLHRLAFNEAFVELGMEGASWSEERYLS
FT                   LLRTGGGTAEGMVERYFHFYGYPTPELRDPTAHIPDEVGQAAMSGSIRPEGWNAEGASV
FT                   AAQAAAIQAAASRNPLNRELLARRRLEWIDEVVAKKDERLRAIVSEGRLKLRKGALDFI
FT                   DECLLEDGAQVVFVGATASAPEEGVLDAVLEAIGPLRAAAITQCGGHEQIDGCEFQSFE
FT                   NYHANNIVKDITANGEVAAREEQLQAVNGDVDVRKEMQAMMKQRKGELLAEEIGGDLQR
FT                   QRFDSNVVVDSGVFCTSTRSVISAEAVRGMLEAKGFGKDRAIFVGASRTTCAEAGAAGV
FT                   FNVLARTAHQADSQITDVACVVDGFGGGGGLTLRYIKRRAAAWDGRAATMDET"
     atggcgcgcg gcaccgggcc atcgaggcgc tcgaaccgcc cttcgtcccg cgcgctcggc        60
     aactccgcgc tcaacacccg cgggatcgcg cgaggcgaac gcggaacccg gggcaaatcc       120
     tcccgcgtcg cgtcgcgggc gacgtcgaac gaggatgacg aaccccccgc gcccgagcct       180
     ctgctcgtga tcgtggaggt cgacggcgtg ctgtgcgacg tgcattgcga ccttcacagg       240
     ctcgcgttca acgaggcgtt cgtcgagctc ggcatggagg gcgcgtcctg gtccgaggag       300
     cgctacctct ccctgctccg caccggcggg ggcaccgccg aagggatggt ggagcggtac       360
     tttcacttct acgggtaccc cacccccgag ctccgggacc cgaccgcgca catccccgac       420
     gaggtcggcc aagccgcgat gtccggctcg attcgacccg aagggtggaa cgccgagggc       480
     gcgtccgtcg ccgcgcaggc cgcggcgatc caggcggcgg cgtccagaaa ccccctcaac       540
     cgcgaactgc tcgcgaggcg aaggctggag tggatcgacg aggtggtggc gaagaaggac       600
     gagcgactcc gcgcgatcgt ctccgagggc cgtctcaagc tccgcaaggg tgcgctcgac       660
     tttatcgacg agtgcctcct cgaggacggc gcgcaggtgg tcttcgtggg agccacggcg       720
     tccgccccgg aggaaggggt cctcgacgca gtgctggaag ccatcggccc gctgcgagcg       780
     gcggccatca cccagtgcgg cgggcacgag cagatcgacg gatgcgagtt ccagtccttc       840
     gagaactacc acgcgaacaa catcgtcaag gacatcaccg ccaacggcga agtcgcggcg       900
     cgggaggagc agttgcaggc ggtcaacggc gacgtcgacg tccgcaagga gatgcaggcc       960
     atgatgaagc agcgcaaggg cgaactgctg gccgaggaga tcggcggcga tctgcagcgc      1020
     caacggttcg acagcaacgt cgtcgtcgac agcggcgtct tctgcaccag caccaggagc      1080
     gtgatcagcg cggaggccgt gcggggcatg ctcgaggcga agggcttcgg caaggatcgc      1140
     gccatcttcg tcggagcctc gaggacgacg tgcgccgagg ctggcgccgc cggtgtcttc      1200
     aacgtcctcg cgaggaccgc gcaccaggcg gactcgcaga tcaccgacgt ggcgtgcgtc      1260
     gtggacggct tcggcggcgg cggcgggctg acgctgaggt acatcaagcg tcgcgccgcc      1320
     gcgtgggacg gtcgcgcggc gacgatggac gagacgtga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page