(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE329

MICSR_1.PE329        Location/Qualifiers
FT   CDS_pept        join(complement(644174..644852),complement(643871..643923))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636959"
FT                   /orf_name="MICPUN_99439"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62184.1"
FT                   /db_xref="UniParc:UPI000199A755"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K6"
FT                   /transl_table=1
FT                   /translation="MVIRVSNDVLVVPPFDCAWLSSPDAESLTTASSEGGEGIVVSFDA
FT                   KADSDVTVILKGRRTSKSELDSRPARRLDHWSGRQDDPAKVDASTYLVIIGSHRNSACV
FT                   IEKNGRVVELAKGPAVPLLPARGRDAFTRCFVSWYPKRGALVVGVGEHLRHAWVDPEPH
FT                   TDPICEIGLSTWDDYAQYRDIEVRALDPDGGSRVNSWSATPADSPRGGRRPAPPPAVAD
FT                   VENLRGATRCARCCRTFGSPR"
     atggtaatca gagtctcgaa cgacgtgctc gtcgtgcccc cgttcgactg cgcgtggctc        60
     tcgagccctg acgcggagag cctgaccacc gcgagctccg agggtggcga aggcatcgtg       120
     gtgtccttcg acgccaaggc tgacagcgac gtcaccgtga tcctcaaagg tcgccgcacg       180
     tccaagtcgg agttggactc gaggcccgcg cggcggctcg accactggtc ggggcgacag       240
     gacgacccgg ccaaggtcga cgcgtcaacc tacctcgtca taatcggcag ccatcgcaac       300
     tccgcgtgcg tcatcgagaa gaacgggcgc gtcgtggagc tcgcgaaagg gccggccgtg       360
     ccgctgcttc ccgcgcgagg ccgcgatgcg ttcaccaggt gcttcgtcag ctggtacccc       420
     aagcgcggcg cgctcgtcgt gggcgtcggg gaacacctcc ggcacgcgtg ggtcgacccg       480
     gaaccgcaca ccgaccccat ctgcgagatc ggcctgtcca cctgggacga ctacgcgcag       540
     tatcgagaca tcgaggtgag ggcgctggac cccgatggcg gatccagggt caactcgtgg       600
     tccgcgacgc ccgcggactc gccgcgcgga ggccgccgcc ccgcgccgcc ccccgcggtt       660
     gcggacgtcg agaacctccg cggggcgacg aggtgcgcga ggtgttgccg cacgttcggt       720
     tccccacgct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page