(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE33

MICSR_1.PE33         Location/Qualifiers
FT   CDS_pept        join(complement(60082..60114),complement(59732..59846),
FT                   complement(59417..59508),complement(58729..59286))
FT                   /codon_start=1
FT                   /gene_family="HOG000264788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636038"
FT                   /orf_name="MICPUN_107852"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62045.1"
FT                   /db_xref="HOGENOM:HBG560144"
FT                   /db_xref="UniParc:UPI000199AB29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R0"
FT                   /transl_table=1
FT                   /translation="MDKASLRLSGRVAAHGNGRIGNEKFTLTASTGFANGGTVTLRATP
FT                   GFSPKYDENEKKLNFQGDAISNVGDIGKLSEIDVQFSKSGVELAGQACDVTVARDHAEG
FT                   DNAAPSGVRIKSNVDKVGDVTITAIQAGHKTLNDEDARAEKNAIRIAADIPLSDVNADL
FT                   TGSVDYDLVSKNANVRIGYHKDDITVKLRTLIKEDGDKRTAASTINLDYSGLEGIGVGV
FT                   EVKDDKTGHLQITKDDFKLKVPIEENKVKTNDASITYNWAIDM"
     atggacaaag cttccctcag gctctccgga cgggtcgccg cccacggcaa cggccgaatc        60
     ggcaacgaga agttcaccct caccgcctct accggctttg ccaacggtgg caccgtgacc       120
     ctcagggcca cccccggttt ctcccccaaa tacgatgaga atgagaagaa gctgaacttc       180
     cagggcgatg ctatctcgaa cgtcggcgac atcggcaagc tctcggagat cgacgtccag       240
     ttctccaagt caggcgtcga gctcgctggc caggcctgcg acgttaccgt cgcccgcgac       300
     cacgccgaag gagacaatgc cgccccctcc ggcgtccgca tcaagtccaa cgtcgacaag       360
     gttggcgacg tcaccatcac cgccatccag gctggccaca agaccctcaa cgacgaggat       420
     gcgcgcgccg agaagaacgc tatccgcatc gccgccgaca ttcccctctc cgacgtcaac       480
     gccgacctca ccggttccgt cgactacgac ctcgtcagca agaacgccaa cgtcaggatc       540
     ggctaccaca aggacgacat caccgtcaag ctcaggaccc tcatcaaaga ggacggtgac       600
     aagagaaccg ccgcatccac gatcaacctc gactactccg gcctcgaggg catcggcgtg       660
     ggcgtcgagg tcaaggacga caagacgggc catctccaaa tcaccaagga tgacttcaag       720
     ctcaaggtcc cgatcgagga aaacaaggtg aagaccaacg acgcgtccat cacctacaac       780
     tgggccatcg acatgtaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page