(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE330

MICSR_1.PE330        Location/Qualifiers
FT   CDS_pept        644995..645621
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636960"
FT                   /orf_name="MICPUN_56907"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61758.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A756"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K7"
FT                   /transl_table=1
FT                   /translation="MAMKTTIWRPNVRVTLDEYGEVEDTERGGEEVTKQGTKRKRAPRP
FT                   KGPCEHGVKYRSRCKVCGACPHGKRRCYCKECGGASICEHGRQRSHCKECGGASICEHG
FT                   RQRHQCKECGGSGICEHGRHRFSCKECGGSGICEHGRIRSACKECGGGSFCEHGRQRSI
FT                   CKECGGAGICEHSRRRSQCKECGGGSICQHGRRRSQCKDCRGERL"
     atggcgatga agacgacgat ctggcggccg aacgtgagag tgacgctcga cgagtatggc        60
     gaagtcgagg acacggagcg aggtggagag gaggtgacga agcaggggac gaagcggaag       120
     agagcccctc gcccgaaggg gccgtgcgag cacggggtga agtatcggtc gcgatgcaag       180
     gtgtgcggcg cttgtccgca cgggaagagg cgctgttatt gcaaggagtg cggtggtgca       240
     tcaatctgcg agcacggccg tcagcgctct cattgcaagg agtgcggcgg tgcatcaatc       300
     tgcgagcacg gtcgtcagcg ccatcagtgc aaggagtgcg gtgggtctgg aatctgcgag       360
     cacggtcgtc accgctttag ctgcaaggag tgcggtgggt ctggaatctg cgagcacggt       420
     cgtatacgct ctgcatgcaa ggagtgcggt ggcggctcgt tctgcgagca cggtcgtcag       480
     cgctctatat gcaaggagtg cggtggggct ggaatctgcg agcacagccg tcggcgctct       540
     cagtgcaagg agtgcggtgg gggctcaatc tgccagcacg gtcgtcggcg ctctcagtgc       600
     aaggactgtc gaggcgaacg tctgtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page