(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE331

MICSR_1.PE331        Location/Qualifiers
FT   CDS_pept        complement(645707..649054)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636961"
FT                   /orf_name="MICPUN_56908"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62185.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A7BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K8"
FT                   /transl_table=1
FT                   /translation="MSTGAADPERVRTSITSMNALLDPLKHLYLNLADADGKTTRARCL
FT                   FALADTGILDDLPCADVGADLGHGFSDDVEVEWTYEDFVNVLGAAIAHRTAHRKPLPAA
FT                   PRGVAQRQLRDLFHLCCNDFDRARPKSNASRLTLHQWLVVCDGADLLTRRFTRDAAAVV
FT                   FARCRRGAETDLGLDQFITCLASLAVETGKTFEAVVSAVSTSPLCTGGAENVAPAKDIA
FT                   PGAAKDTYKTPGKVRVPTVFGGAKPKTPGAALKTPGASLKTPGASLKTPGASLKTPGAS
FT                   LKTPGASLKTPGASLKTPGAPNDVRYTAALESAVESPDAKSFETHDADGDGLLNRHELA
FT                   SLLAQGDSASVDGAIELVSKLFDDVDLDRDGRVCLAEYEAFCKKARRTLRRRTMSSAHG
FT                   PTASAPVPATYATDARLEEMFVAYCVVGAAKTPAKERTTNEGSVHVNNQNAFAAKRTID
FT                   ERRFLRVLKDAKLTGPGFLSQQQAQLCFHSQCARNERKLDHAGFLRALGAVVAHSGPGA
FT                   TYESIADAVKSLPIPDKLSAAVIERTIAPQPPARAGTGVGPRPHSARAGIGSFSTSSSS
FT                   SSGDSGFGARANAAVRTRPKSAKPRVSVSFADDDDVKSDVKSDVKSDVKSDVKSDVKSD
FT                   VKSESTAPDALLAAFDRRDAEANDGDVTGVASIGVCRLALADVAGLNGADAAAVADAFR
FT                   DVFEAFAVRAKLRREKLGEFKRKFDARVANLALAGAPLVPPVQVPPMSAPQSDAISGVF
FT                   DSTVGTSAGAPDFMTAAEFASLLSAAGLIDTDADADAVEVTFCRCVGGKPRGDADFASF
FT                   VTALAAIAGERRLTFFQVAAPVVDAAMRARAARGKEKEAGNETGDAAEPEAEPEPEAEP
FT                   EPEAAPEPEPEAAAAPEPEASEPEKAEAAQTAAPPLTEEERAVWAQEFKSHDEAESKSG
FT                   FVDVERVSFALAKLRLLEDVDVALAASELEASVKIVDPSGVGALDLDAFIAVGAAVRAL
FT                   KLGGRAKPSAKPVPVQREYVFDDSHPFAAKFRAVADVNGEIDGDSYRALLDRAGLLHDG
FT                   SRGSSETPETRLTNAGAAVVFARAKARHPGHGRRVPYRIFLGALSLSAGHLGMSFAEVV
FT                   ERIMATEL"
     atgagcaccg gcgcggcgga ccccgagcgg gttcggacga gcatcacctc catgaatgct        60
     ctcctcgatc cgctcaagca tctgtacctc aacctggcgg acgccgacgg caagacgacc       120
     agggcccgtt gcctcttcgc cctcgccgat accggcatct tggacgacct cccctgcgcc       180
     gacgtcggcg ccgacctcgg ccacggcttc agcgacgacg tcgaggtgga gtggacgtac       240
     gaggacttcg tgaacgttct cggcgctgcg atcgcgcacc gcaccgcgca ccgcaagccc       300
     ctccccgcag cccccagggg cgtggcgcag aggcagctgc gggatctgtt tcacctctgc       360
     tgcaacgact tcgaccgcgc gcgacccaag agcaacgcgt ccaggctcac gctgcaccag       420
     tggctcgtcg tgtgcgacgg cgcggacctg ctcacccgca ggttcacccg cgacgccgcg       480
     gccgtggtct tcgcgcggtg ccggcggggc gctgagaccg acctcggcct cgatcagttc       540
     atcacgtgcc tcgcgtcgtt agcggtggag accggaaaga ccttcgaggc ggtcgtatcc       600
     gcggtcagca cctcgccgct gtgcacgggg ggagccgaga atgtcgcccc ggccaaggat       660
     atcgccccgg gggccgcgaa ggacacgtac aagacgccgg ggaaggtgag ggtgcccacg       720
     gtattcggag gtgccaagcc caagacaccc ggagcggcgc tcaagacccc aggagcctcg       780
     ttgaagaccc caggagcctc gttgaagact cccggagcct cgttgaagac cccgggggcg       840
     tctttgaaga cccctggggc gtcgttgaag accccggggg cgtcgttgaa gacccctggg       900
     gcgccaaacg acgtccggta caccgccgcc ctcgaatccg ccgtcgaatc cccggatgcc       960
     aaatcgttcg aaacgcacga cgccgacggc gacggactcc tcaaccgtca cgagctcgcc      1020
     tccctcctcg cccaggggga ctccgcgagc gtcgacggcg cgatcgagct ggtgtcgaag      1080
     ctattcgacg acgtggacct cgatcgggac ggccgcgtgt gcctcgccga atacgaggct      1140
     ttttgcaaaa aggcgcggcg gacgctcagg aggcggacga tgtcgtcggc gcacgggccc      1200
     accgcgtcgg cgcccgtccc ggccacgtac gccacggacg cgcgactgga ggagatgttc      1260
     gtggcgtact gcgtcgtggg agccgcgaag acgccggcga aggaacgaac gacgaacgaa      1320
     ggttccgttc acgtgaacaa ccaaaacgct ttcgccgcca aacgaaccat cgacgagcga      1380
     aggttcctcc gcgtgctcaa ggacgccaaa ctcacaggcc cgggcttcct ctcgcagcag      1440
     caggcgcagc tgtgcttcca ctcgcagtgc gccaggaacg agcgcaagct ggaccacgcg      1500
     ggtttcctga gagccctcgg cgccgtcgtc gcgcactcgg gccccggcgc tacgtacgaa      1560
     tcaatcgccg acgccgtcaa gtcgctaccc atcccggata agctctccgc cgcggtcatc      1620
     gagcgcacga tcgcgcccca accccccgcg cgagccggca ccggggttgg accgcgaccg      1680
     cacagcgcgc gcgccggcat cgggtcgttc tcgacgtcgt cgtcgtcgtc gtcgggcgac      1740
     tccggttttg gcgcccgcgc gaacgccgcg gttcgaacca ggccgaagag cgcgaaaccc      1800
     cgggtcagcg tgtccttcgc ggacgacgac gacgtcaagt ccgacgtcaa gtccgacgtc      1860
     aagtccgacg tcaagtccga cgtcaagtcc gacgtcaagt ccgacgtcaa gtccgagtcc      1920
     accgcgcccg atgccctgct tgccgcgttt gaccgccgcg acgccgaggc gaacgacgga      1980
     gacgtgaccg gcgtcgcgtc catcggggtt tgccgactgg cgctcgccga cgtcgcgggt      2040
     ctcaacggcg cggacgccgc cgccgtcgct gacgcgttcc gcgacgtctt cgaggcgttc      2100
     gcggtgcgag cgaagctccg gcgcgaaaag ctcggcgaat ttaaacgaaa gtttgacgct      2160
     cgagtcgcga acctcgcgct cgcgggcgcg ccgctcgttc cccccgtgca ggttcccccg      2220
     atgtccgcgc cccaatcgga cgcaatctcc ggcgtcttcg actcgaccgt gggaacgtcc      2280
     gcgggcgcgc cggactttat gaccgccgcc gagtttgcct cgctgctatc agccgcgggg      2340
     ctcatcgaca ccgacgcgga tgccgacgcc gtcgaggtca ccttctgcag gtgcgtcggc      2400
     ggtaagcccc gcggcgacgc ggatttcgcc tccttcgtca ccgcgctcgc ggcgatcgcg      2460
     ggtgagcgga ggctgacgtt cttccaggtg gcggcgccgg tggtggacgc ggcgatgcga      2520
     gcgcgggcgg ctcgagggaa ggaaaaagag gcggggaacg agaccgggga cgcggcggag      2580
     cccgaggcgg agcccgagcc cgaggcggag cccgagcccg aggcggcgcc cgagcccgag      2640
     cccgaggcgg cggcggcgcc cgagcccgag gcgtcggagc ccgagaaggc ggaggcggcg      2700
     cagacggctg ctcccccgct gacggaggag gaacgcgcgg tttgggcgca agagttcaaa      2760
     tcccacgacg aagccgagtc caaatccggc ttcgtcgacg tcgagcgcgt ctccttcgcg      2820
     ctcgccaagc tccggctcct ggaggacgtc gacgtcgccc tcgccgcgtc cgagctcgag      2880
     gcgagcgtca agatcgtgga cccgtcgggc gttggcgcgc tggacctgga cgcgttcatc      2940
     gcggtgggtg cagcggtgag ggcgctcaag ctcggcggcc gagcgaagcc gagcgccaag      3000
     ccggttcccg tgcagcgcga gtacgtcttc gacgactccc acccgttcgc cgccaagttc      3060
     cgggccgtcg ccgacgtcaa cggcgagatc gacggcgact cgtaccgcgc gctgctcgat      3120
     cgcgcgggtt tgttgcacga cgggtcccgc gggtcctcgg agactccgga gacgaggctg      3180
     acaaacgccg gcgccgcggt cgtgttcgcg cgggccaagg cgaggcaccc gggacacggg      3240
     cggcgggtgc cgtacaggat cttcctcggg gcgctgtcgc tgagcgcggg gcacctgggt      3300
     atgagcttcg cggaggtggt ggagaggatc atggcgaccg agttgtga                   3348
//

If you have problems or comments...

PBIL Back to PBIL home page