(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE332

MICSR_1.PE332        Location/Qualifiers
FT   CDS_pept        649408..650736
FT                   /codon_start=1
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636962"
FT                   /orf_name="MICPUN_52211"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="ACO61759.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG525531"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199A7C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K9"
FT                   /transl_table=1
FT                   /translation="MALFGAGGSPAVCSSLYILDSNLKTLLMRDWRGDTNPSMVERFVS
FT                   IVNNAESESELKPIIYDDEIQTSFTYIRHRDLYFLALTRTNANAVALLTFLHRLVDIFT
FT                   HYFKELKEESIRDNFVIIYELLDEVMDNGYPQFTEAKILSEFITVGAHELQAPKAPMAV
FT                   TNAVSWRSEGLRYQKNEVFLDVVESCNCVVNANGQIVNSEVNGALRMRTQLSGMPECKL
FT                   GLNDKVMLQAQNKSTRGKSVELEDIKFHQCVRLARFESDRTISFIPPDGQFDLMNYRIT
FT                   TPVKPLIWVEAKVTRPSRSRVEYSVKLRTQFKSRLNATGIEVKLPVPGDATTPEVKAAL
FT                   GSVTYAPEQEAMLWKIKTVPGEKVVEMRAKFSLPSVSALEDDGPRQKKPPVMVKFEVPY
FT                   FTVSGVQVRFLKVIEKSGYQALPWVRYITKAGTYEFRLDHQSS"
     atggcgttgt ttggggcagg aggcagcccc gcggtgtgct cctcgctgta catcctggac        60
     agcaacctca agacactgct catgcgggac tggcgcggcg acacgaaccc ttccatggtc       120
     gagcgcttcg tctccatcgt gaacaacgcc gagtccgagt ccgagctcaa gccgatcatc       180
     tacgacgatg agatccaaac atccttcacg tacatccggc accgcgacct gtacttcctc       240
     gcgctcaccc gcacgaacgc caacgcggtg gcccttctca cgttcctcca cagactcgtg       300
     gacatcttca cgcactactt caaggagctc aaggaggagt ccatcaggga caacttcgtg       360
     atcatctacg agctgctgga cgaggtgatg gacaacgggt acccccagtt caccgaggcg       420
     aagatcctga gcgagttcat caccgtcggc gcgcacgagc tgcaggcgcc caaggccccg       480
     atggcggtca ccaacgcggt gtcgtggcga tcggagggtt tgcgctacca gaagaatgag       540
     gtttttctcg acgtcgtaga gtcttgcaac tgcgtggtca acgcgaatgg gcagattgtc       600
     aactccgagg tgaacggcgc gctgcggatg cgcacccagc tgagcgggat gcccgagtgc       660
     aagcttgggc tcaacgataa ggtgatgctc caggcgcaga acaagagcac gcgggggaag       720
     agcgtggagc tcgaggatat caagtttcac cagtgcgttc ggctggcgcg cttcgagagc       780
     gacaggacca tctcgttcat acccccggac ggccagttcg atctgatgaa ctacaggatc       840
     accaccccgg tcaagcccct gatctgggtc gaggcgaagg tcacgaggcc ctcgaggtcc       900
     agggtagagt acagcgtcaa gctccggacg cagttcaagt cgaggctgaa cgcgacgggc       960
     atcgaggtta aactcccggt gccgggggac gcgaccactc cggaggtcaa agccgccctg      1020
     gggagcgtca cgtacgcccc ggagcaggag gcgatgctgt ggaagatcaa gacggttccc      1080
     ggggagaagg ttgtcgagat gagggcgaaa ttttcgttgc caagcgtgag cgcgctcgag      1140
     gacgacgggc cgaggcagaa gaagccgccg gtgatggtca agttcgaggt gccgtacttc      1200
     acggtgtccg gggtgcaggt ccggttcctg aaggtgatcg agaagagcgg gtatcaggcg      1260
     ctgccgtggg tgaggtacat caccaaggcg gggacgtacg agttcaggct ggaccaccag      1320
     tcctcgtag                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page