(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE333

MICSR_1.PE333        Location/Qualifiers
FT   CDS_pept        join(complement(651599..652086),complement(651282..651488),
FT                   complement(651137..651209))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636963"
FT                   /orf_name="MICPUN_56910"
FT                   /product="Fasciclin family protein "
FT                   /protein_id="ACO62186.1"
FT                   /db_xref="HOGENOM:HBG750250"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199A7C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L0"
FT                   /transl_table=1
FT                   /translation="MPHTKRPLLLAALALVAFAALFNPAAAGDTAAVGTMDPPKEDALL
FT                   MPTDAEADPAATDAAAKEMDMAPDMDMEPAAEEDAELKPLGETLQADPEFSTLVALVTA
FT                   AADESGATAEDLAAEGPFTLFAPVNEAFTKFLETSGLSVEDVLASPDLKEILSHHVVEG
FT                   KYTAADVLAMELPAEVPTLDGHTIKIDKTTDGDVLIAGNKVVAPDIEASNGVIHGIDGV
FT                   ITETTPEPEDTTTNEEVTSTALLGTLYAAVLVM"
     atgccgcaca cgaagcgccc ccttctcctc gccgccctcg cgctcgtcgc gttcgccgcg        60
     ctgttcaacc ccgcagccgc cggggacacc gccgcggtcg ggacgatgga ccctcccaag       120
     gaggacgcgc tgctgatgcc cacggacgcg gaggcggacc ccgccgcgac cgacgcggcg       180
     gcgaaggaaa tggacatggc gcccgatatg gatatggaac ccgcggccga ggaagatgcc       240
     gagctcaaac ccctcggcga gacgctgcag gctgacccgg agttctccac gctcgtggcg       300
     ctggtgaccg ctgccgctga cgagagcggc gccaccgccg aggatctcgc agccgaaggg       360
     cctttcacct tgttcgctcc cgtgaacgag gcgttcacca agttcctcga gacatccggg       420
     ctcagcgtcg aagacgtcct cgcgagcccc gacctcaagg agatcctctc gcaccacgtg       480
     gttgaaggca agtacaccgc cgccgacgtc ctcgccatgg aactccccgc cgaggtcccg       540
     accctcgacg gccacaccat caagatcgac aagaccaccg acggcgacgt tctcatcgcc       600
     ggtaacaagg tcgtcgcgcc cgacatcgaa gcgtccaacg gggtcatcca cggcatcgac       660
     ggcgtcatca ccgagacgac gccggagccg gaggacacga cgacgaacga ggaggtgacc       720
     agcacggcgc tgctcggcac gctgtacgcg gcggtgctcg tcatgtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page