(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE336

MICSR_1.PE336        Location/Qualifiers
FT   CDS_pept        657228..658970
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636966"
FT                   /orf_name="MICPUN_56913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61761.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199A7C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L3"
FT                   /transl_table=1
FT                   /translation="MSTASAGSSGSIVIGARHGYARRTALRSSPGRRRLRTCAGKLSQR
FT                   KTRGSRGLSVVAEQHGISLEDARALFSKRFCKGSGVHLELQETPTGRGLVATAPVAPGD
FT                   VLITVPWREAIHVLEDGYSDGDDLRLALELLHVLDDGDEDGYIDGEYDARVKTWRKYRP
FT                   MLPVSTGAAAFWCVDNIRELQFPEAVEKTLAQRAEFTAGAMRHSNDSRTKERIMWALQQ
FT                   VHSRSFSVMTPQGRARCLVPYVDLFNHRPESPKEARMTDELLQRALRKAFTKGSEEGIN
FT                   DGEWAGAEPWQVVGPDPEDLENWEDAAVFQMRSIWAYEPGEEVFITYGHETSAELLTSY
FT                   GFFPEPNDGEFIRVYENVQDLIDDDRFVDEELNSPALQMEKEQFMWSMLAVEAPLAIRP
FT                   GGVRESAHLLSALRVVHARENQLAAMRDDDVPRIGHSTFVWTEGDEPCGMWDPDRFLSC
FT                   FFDESCDSDEWLWDDDDARDRDATDRAALAQACARCEEILRDDFATTLEEDQVMLDEIE
FT                   EAIRGLSPEEADEDPEGHLEYVAALRYRMSVKRILRDFISECKRAYGVEAEALKAEPEF
FT                   EYIE"
     atgtcgaccg cgagcgccgg gtcgtcgggt agtatcgtca taggagcgcg gcatgggtac        60
     gcgcggagga cggctctccg gagcagcccc ggtcggagga ggctccggac gtgcgcgggt       120
     aagctgagtc agcggaaaac tcgtggctcc cgagggctct ccgtcgtcgc cgagcaacac       180
     ggcatatcgt tagaggacgc gcgggcgctg ttctccaagc gattctgcaa gggcagtggg       240
     gtgcacctgg agcttcagga gactccgacc ggtcgcggcc tcgtcgccac cgcgcccgtc       300
     gcgccgggcg acgtcctcat caccgtcccg tggcgcgaag ccatccacgt cctcgaggac       360
     gggtactccg acggcgacga cctgcgcctg gcgctagagc tgctgcacgt gctggacgac       420
     ggcgacgagg acgggtacat agacggcgag tatgatgcca gggtcaagac ctggaggaag       480
     taccgcccca tgctgccggt atccaccggg gcggccgcgt tctggtgcgt cgataacatc       540
     agggagctgc agttcccgga ggctgtggag aagacgctgg cgcaacgcgc ggagttcacg       600
     gcgggcgcta tgcggcacag caacgactcg cgcaccaagg aaaggatcat gtgggcgctg       660
     cagcaggtgc acagcaggag cttcagcgtg atgaccccgc agggacgggc gcgttgtctg       720
     gtgccctacg tcgacctctt caaccatcga cccgagtcgc ccaaggaggc caggatgacg       780
     gacgagctcc tgcagcgcgc gttacgaaag gcgttcacga aaggcagcga ggagggcatc       840
     aacgacggcg agtgggcggg cgccgagccg tggcaggtgg tcggcccgga ccccgaggac       900
     ctcgagaact gggaggacgc ggctgtgttt cagatgcggt ccatctgggc ctacgaacct       960
     ggcgaggagg tgttcatcac gtacggtcac gaaacctccg cggagttgct gacgtcgtac      1020
     gggttcttcc ccgagcccaa cgacggcgaa ttcatcaggg tgtacgaaaa cgtccaggac      1080
     ctcatcgacg acgatcggtt cgtggatgaa gagttgaact ctcccgcgct gcagatggag      1140
     aaggagcagt tcatgtggtc gatgctcgcg gtggaggccc cgctcgcgat aaggccgggc      1200
     ggcgtacgcg aatccgcgca cttgctcagc gccctgcgcg tcgtacacgc gcgcgagaac      1260
     cagctcgccg cgatgaggga cgacgacgtt ccgaggatcg gtcacagcac gttcgtgtgg      1320
     acggagggcg acgagccgtg cggcatgtgg gaccccgacc ggttcctctc ctgcttcttc      1380
     gacgagtcat gcgacagcga cgagtggctc tgggacgacg acgacgcgag ggacagggac      1440
     gcgaccgacc gcgccgcgct cgcgcaggcg tgcgccaggt gcgaggagat cctgcgcgac      1500
     gatttcgcca cgacgctcga ggaggaccag gtcatgctcg acgagatcga ggaggccatc      1560
     cgcgggctct ctccggagga agcggatgaa gacccggagg gacacctgga gtacgtcgcg      1620
     gcgctgaggt acaggatgag cgtcaagcgg atcctgcggg acttcatcag cgagtgcaag      1680
     cgggcgtacg gcgtggaggc cgaggcgttg aaggctgaac ccgaatttga gtacatcgag      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page