(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE337

MICSR_1.PE337        Location/Qualifiers
FT   CDS_pept        complement(<659196..>659642)
FT                   /codon_start=1
FT                   /gene_family="HOG000236769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636967"
FT                   /orf_name="MICPUN_72663"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62188.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG657462"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199A7C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L4"
FT                   /transl_table=1
FT                   /translation="FHDPRGTLVEIGMGTGPNMRYYEGLNVVGVEPNEESHSYAYENAN
FT                   RNGVKSIECVRGFGESLPLGDASVDTVVSTLVMCTVDDVERTLAEVRRVLRPGGAYLFL
FT                   DHVAAPPGTPLRTMQEMLNPLNRAAYEGCRLTRDPEAAVRAAFGD"
     ttccacgacc cgcggggcac cctcgtcgag atcggcatgg gcaccggacc gaacatgagg        60
     tactacgagg gactcaacgt cgtgggcgtc gagcccaacg aggaatctca ctcctacgcg       120
     tacgagaacg cgaacaggaa cggggtcaag tcaatcgagt gcgtcagggg gttcggcgag       180
     tcgcttcccc tgggagacgc ctcggtggac acggtggtga gcacgctggt gatgtgcacg       240
     gtggacgacg tggagcgcac gctcgcggag gtcaggaggg tactcaggcc gggcggcgcg       300
     tacctgttcc tcgaccacgt ggcggcgccc ccgggcacgc cgctgcggac gatgcaggag       360
     atgctcaacc cgctgaacag ggcggcgtac gaggggtgca ggctgacgcg cgacccggag       420
     gcggcggtga gagccgcgtt cggcgac                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page