(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE338

MICSR_1.PE338        Location/Qualifiers
FT   CDS_pept        660248..661375
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636968"
FT                   /orf_name="MICPUN_56915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61762.1"
FT                   /db_xref="UniParc:UPI000199A7C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L5"
FT                   /transl_table=1
FT                   /translation="MAHFQHTCNACLKPICEGDVYITRCGHRFCERPRDRDLLASSPSS
FT                   LLAPLPSSRARARRLTTSAPPAVCTQATTTREGCVRRASARRAARRSTGRRISRCGACS
FT                   DRPRPSCAFFDRPFNRQAFAVRPGEEVSEALRGFDPGTIMTAAFNGINWWCEQAALVQE
FT                   MSSRRVQEEGRAHAEGYKSKLLEVHSAYKRAKAKAEALWQQMQQLELDKKELQSKYEQK
FT                   SGEKRRIEASYRELQSRGGVAGGGGGGGGGGHPRAPPSMPPPSRHAYQHMSSPPVHLGS
FT                   PPLDRNISRPASRPSMANFGGGNRPLLSGFPAGAAQTRPISPYSGDLMSPPQDYLDDRR
FT                   EWRRGGNRGAPRASRGGYRPPHSPTRSHHTFSIGN"
     atggcgcact tccagcacac gtgcaacgcg tgtttgaagc ccatctgcga gggcgacgtg        60
     tacatcacga gatgcggtca ccggttctgt gagcgcccgc gcgaccgcga cctcctcgct       120
     tcctccccct cttctcttct cgcgccactt ccttcgtcga gagcacgcgc gcgaagactg       180
     acgacgagcg ccccgcccgc cgtttgcacg caggctacga cgacgcgaga aggctgtgtg       240
     agacgggcga gtgcgcgacg tgccgctcgc aggtctacgg ggagaaggat atccaggtgc       300
     ggcgcctgct ccgaccgccc gagacccagc tgtgcatttt ttgaccgccc tttcaaccgt       360
     caggcgttcg ccgttcggcc cggcgaagag gtcagcgagg ccctccgcgg gttcgacccg       420
     ggcacgatca tgaccgctgc gtttaacggc atcaactggt ggtgcgagca ggcggcgctc       480
     gtccaggaga tgtcgtcgag gagggtacaa gaagaggggc gcgcgcacgc agaggggtac       540
     aagtccaagc tcctcgaggt gcactccgcg tacaagcgag ccaaggccaa ggcggaggcg       600
     ctctggcagc agatgcagca gctcgagctc gacaagaagg agctccagag caagtacgag       660
     cagaagagcg gggagaaacg ccgcatcgaa gcatcctacc gcgagctcca gagccgcggc       720
     ggagtggcgg gaggtggagg aggaggaggg ggaggcggcc acccgcgcgc ccctccttcg       780
     atgcccccgc cctcccgcca cgcctaccag cacatgagca gcccgcctgt gcacctcggc       840
     agcccgccct tggaccgcaa catctcccgc cccgcgtccc ggccgtccat ggccaacttc       900
     ggcggcggca accgccccct gctctcgggc ttccccgcgg gagctgcgca gacccgaccc       960
     atctccccct actcgggcga cctgatgagc ccgccgcagg actacctgga cgacaggcgc      1020
     gagtggcgca ggggcgggaa ccgcggcgca cccagggctt cgagaggggg gtaccgcccg      1080
     ccgcactcgc ccacccgctc gcaccacacg ttttccatcg ggaactga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page