(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE34

MICSR_1.PE34         Location/Qualifiers
FT   CDS_pept        complement(<60993..>62148)
FT                   /codon_start=1
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636039"
FT                   /orf_name="MICPUN_68791"
FT                   /product="Predicted protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="ACO62046.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000199AB2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R1"
FT                   /transl_table=1
FT                   /translation="TDPDGPLAGLTFAVKDNLDVAGHRTGCGQPTWLDTHPEPARQHAP
FT                   PVASLLAAGAACVGKTQMDELAWALQGENHHYGTPINPAAPERVPGGSSSGSAVAVAAG
FT                   YADVALGTDTAGSVRVPASYCGLCGFRPTHGRVDATRGCVPLAPSFDVVGWFARDATTM
FT                   LRCGSVLLPPWGAWDTAFDLRFDGAIARDAFELCDEETRATLREAVARACGPGPLGEAG
FT                   GGTVEVDVGGGGSTPPLTEWWNVFRVIQANEVWRAHGAWVSEHQPRFGPGVKERFEGAG
FT                   GVTDAEAAEASKTRDAIAASMESTMVDEATGKDRFLFLPTSPGPPLASGADAQTVESFR
FT                   NRQLRLTAAAGLARLPQATVPVPRRSGPPLGLSVVGPRGTDEALL"
     acggacccgg acggacccct cgcgggtctc accttcgcgg tcaaggacaa cctcgacgtg        60
     gcgggccatc gcacgggctg cggccagccc acctggctcg acacccaccc ggaacccgcg       120
     cgccaacacg cgccccccgt cgcctcctta ctcgccgcgg gcgccgcgtg cgtgggcaag       180
     acgcagatgg acgagctggc gtgggcgctg cagggcgaga accaccacta cggtaccccg       240
     ataaaccccg ccgcgcccga acgcgtcccg gggggatcat cctccggatc cgccgtcgcc       300
     gtcgccgccg gatacgccga cgtcgcgctg ggcacggaca ccgcgggcag cgtcagggtc       360
     ccggcgtcgt actgcgggct gtgcgggttc aggcccacgc acggccgcgt ggacgccacg       420
     cgcgggtgcg tcccgctcgc cccgtccttc gacgtcgtcg ggtggttcgc cagggacgcg       480
     acgacgatgc tccgatgcgg ctccgtttta ctccctccgt ggggcgcgtg ggacaccgcg       540
     ttcgacctga ggttcgacgg ggcgatcgcg cgggacgcgt tcgagctgtg cgacgaggag       600
     acgcgggcga cgctgaggga ggcggtggcg agggcgtgcg gacccgggcc gttgggcgag       660
     gccggggggg gaacggtcga ggttgacgtc ggcggcggcg gatcgacgcc gccgctgacg       720
     gagtggtgga acgtgttccg cgtgatccag gccaacgagg tgtggcgcgc gcacggcgct       780
     tgggtcagcg aacaccaacc acgcttcggg ccgggggtta aggagaggtt cgagggcgcg       840
     ggtggggtga cggacgccga agcggcggag gcgtcaaaga cgagggacgc catcgccgcg       900
     tcgatggagt cgacgatggt ggacgaggcg acgggcaagg acaggttctt gttcctgccg       960
     acgtcccccg ggcccccgtt ggcgtcgggg gcggacgcac agacggtgga atcgttcagg      1020
     aatcgtcagc tgaggctcac cgcggcggcg ggtctcgcga ggctgccgca ggcgacggtg      1080
     ccggtgccga gacgatcggg gccgccgctc gggctgagcg tggtgggacc gcgcgggacg      1140
     gacgaggcgc tgctga                                                      1156
//

If you have problems or comments...

PBIL Back to PBIL home page