(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE340

MICSR_1.PE340        Location/Qualifiers
FT   CDS_pept        662781..>663746
FT                   /codon_start=1
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636970"
FT                   /orf_name="MICPUN_80010"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO61763.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199A7C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L7"
FT                   /transl_table=1
FT                   /translation="MHGPRGPPPDIAVEILASLIVSTVALLAGTVAVKALDPNRGAKKK
FT                   ADAMKRDIARRLGRPNIVTTPYEDMIATDVANPNAISTTFDEIGGLGETKRALQEIVIL
FT                   PLLRPELFSGGSLLKPVKGCMLYGPPGTGKTLLAKALAKECQACFINVRSSTLQSKWFG
FT                   DANKLVAAVFSLAWKLQPSIIFIDEVDSFLGARKGSEHEASTSMKTEFMTMWDGFQTNE
FT                   NARVMVLAATNRPWEVDEAILRRLPRSFEVGLPNLEQRIDIIKVILKDEHMEPGFFGPG
FT                   PDPPVLKIAKATDRYSGSDLKELCKSAAMGPIRDLLASEAR"
     atgcacggcc cgcggggtcc gccccccgac atcgcggtcg agatcttagc ctcgctcatc        60
     gtctccaccg tcgccctcct cgcgggcacc gtcgcggtca aggcgctcga tcccaaccgc       120
     ggcgcgaaga agaaggcgga cgcgatgaag cgcgacatcg cgcggcgcct cggcaggccc       180
     aatatcgtca ccacccctta cgaagacatg atcgccaccg acgtcgccaa ccccaacgcc       240
     atctccacca ccttcgatga gatcggcggg ctgggcgaga ccaagcgcgc gctgcaggag       300
     atcgtcatcc tccccttgct ccggcccgag ctcttctcag gcggctccct cctcaagccc       360
     gtgaagggat gcatgctcta cggccccccg ggcaccggca agaccttact cgccaaggct       420
     ctcgccaagg agtgccaggc ttgcttcatc aacgtccgat cctccacgct gcagtccaag       480
     tggtttggcg acgccaacaa gctcgtcgcc gcggttttct ccctcgcgtg gaagctccag       540
     ccgtccatca tattcatcga cgaggtggac tccttcctgg gcgccaggaa gggcagcgag       600
     cacgaggcga gcacctcgat gaagacggag ttcatgacga tgtgggacgg gtttcagacg       660
     aacgagaacg cccgagtgat ggtcctcgcc gcgacgaacc ggccgtggga agtggacgag       720
     gcgatcctga ggcgcttgcc caggtccttc gaggtgggcc tgcccaacct cgagcagcgc       780
     atcgacatca tcaaggtcat actgaaggac gaacacatgg agccgggttt cttcggcccc       840
     gggcccgacc cgccggtgct caagatcgcc aaggccaccg accggtacag cggatcagac       900
     ttgaaggagc tgtgcaagag cgccgcgatg ggacccatcc gcgacttgct cgcgagcgag       960
     gcgagg                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page