(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE341

MICSR_1.PE341        Location/Qualifiers
FT   CDS_pept        complement(664379..665470)
FT                   /codon_start=1
FT                   /gene_family="HOG000256919" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636971"
FT                   /orf_name="MICPUN_56918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62190.1"
FT                   /db_xref="HOGENOM:HBG315524"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A7C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L8"
FT                   /transl_table=1
FT                   /translation="MDPMGLSAGPNILELYQKPVNITTYDTKWIPTSARFVVLGSYARA
FT                   TGCLQIYSLDTENEGVKLNKELEKKAAFKCGTFGASSLRERHLATGNFEGYLQLWDLQR
FT                   PEKPLMDVKAHTSIVNAIDGAGGQRSGYGPPELVTGGRDGCVRVWDVRQKDAPVAIFEP
FT                   AEGVKARDCWSVAFGNSFNDEERCVLAGYDNGDVKMFDLRTGTVRAEHNVRNGVCSVEF
FT                   DRKEIAMNKFVVTCLESAFTVFDARTQHPAKGFSSVTEKVPVSATVWGAKHLPQNREVS
FT                   MVLGGDGTLMLYKYQYPDQRVVKDKDGVKMGVAGTMNLVNSKNVSTQPISSWDWSPDKE
FT                   GLAVCGSFDQTVRVVCATRLNTL"
     atggacccca tgggcctttc cgccggccca aacatcctgg agttgtacca gaagccggtg        60
     aacatcacca cctacgacac caagtggata cccaccagcg cgcggttcgt ggtcctcggc       120
     tcgtacgctc gggccacggg atgcctccag atctactcgc tcgacacgga gaacgaaggc       180
     gtgaagctca acaaggagct cgagaagaag gcggccttca agtgcggaac cttcggcgca       240
     tcctccctcc gcgagcgtca cctcgcgacg ggtaacttcg agggctacct gcagctgtgg       300
     gatctccagc gcccggagaa gccgctcatg gacgtcaagg cgcacacctc gatcgtcaac       360
     gccatcgacg gcgccggggg tcagaggagc ggctacggcc cgcccgaact cgtcaccggc       420
     ggccgcgacg ggtgcgttcg cgtgtgggac gtccgccaga aggacgcgcc cgtcgccatc       480
     ttcgaacccg cggaaggggt caaggcgagg gattgctgga gcgtcgcatt tggcaactcc       540
     ttcaacgacg aagagcggtg cgtgctcgcc gggtacgaca acggcgacgt gaagatgttc       600
     gacctgcgaa ccgggacggt gcgagccgag cacaacgtga ggaacggcgt gtgttccgtg       660
     gagttcgacc gcaaggagat cgccatgaac aagttcgtgg tgacgtgtct ggaatcagcg       720
     tttaccgtgt ttgacgctcg gacgcaacac ccggcgaagg gtttcagctc ggtgacggag       780
     aaggtgcccg tgagcgcgac ggtgtggggg gcgaagcacc tgccgcagaa ccgcgaggtg       840
     agcatggttc tgggcgggga cgggaccctg atgctgtaca agtatcagta cccggatcag       900
     agggtggtga aggacaagga cggggtcaag atgggcgtgg cggggacgat gaacctggtc       960
     aactcgaaga acgtgagcac gcagccgatc agcagctggg actggtcgcc tgataaggag      1020
     ggtctggcgg tgtgcgggtc tttcgatcag accgtgcgcg tcgtctgcgc gacccggcta      1080
     aacacgctgt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page