(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE342

MICSR_1.PE342        Location/Qualifiers
FT   CDS_pept        665607..667811
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636972"
FT                   /orf_name="MICPUN_56919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61764.1"
FT                   /db_xref="UniParc:UPI000199A7CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L9"
FT                   /transl_table=1
FT                   /translation="MNRRGGVAALIALAMVTFVYLAYVSGVGNMYLPSESVASTTSSPV
FT                   GRVAIPARIANPSPPAPAPLVDERPEPAPEPRASPAPTSPAVVRDDRKDEGRKLPMECP
FT                   MVDVADPENVAAVARSLGDASDVVVFATQDIEHWRAEFLVNVILNLMSVNVTSVVTVGR
FT                   HKHTCESARRDNPDVVRCCVYSTWLDGHDALKRWTLAEDHAYVLWLIRYRFALDIMRAG
FT                   EVGVLVSDSDMWFERDPFELLKDAATGLGTHSVVANVEGEPFPSMNGGLVYFRADLPGK
FT                   GGRYLLEVFNDHVDDLLADESPPECHKEQGVGTQVVWGAMMDQDILRDAAETAVAGAPL
FT                   WWSYTHHVCLFKGGYDEATKAKMEIKSKHPETLDWSRSGRSLPRPFQSHPAVEALGDEH
FT                   PLNESEEKYGIMKVPNYETWRNLTILAAPKWMFANHGDGDGWFALRPRPGAAFHCMSQN
FT                   QGIKPRMLRAYDMWHWDVLGAGRGIRVGQGRYLSLASAAFGHFTKRGEFAMQAHRLAAL
FT                   AAATGRIPVLPMIPCASPWLDDWRRPDDCYAGVLERINVLAGTCPVTALRQFQGPDAAY
FT                   PGDPAAEGSVGSPCCYFVPPGDDCEEKFAAWGAEMTGEDPHNRPGRTVRLDAIIDAAQL
FT                   VVDAGDATEYADRSWVLGDDFPPDNAKHPTDVFVDFGRVVKAIEGDGDQNTPWVEIDMR
FT                   GKDALPRVVTQRGVDDKSRRKWFMDYNAACPLVNRVSPMV"
     atgaatcgtc gcggcggcgt cgccgctttg atcgccctcg cgatggtcac gttcgtgtac        60
     ctcgcgtacg tgagcggcgt ggggaacatg tatctcccct ccgagagcgt cgcgtcgacc       120
     acctcgtcgc ccgtcggtcg agtcgcgatc cccgcgcgga tagcgaaccc gagccctccg       180
     gcgcccgcgc cgctcgtaga cgaacgcccc gaacccgctc ccgagccacg tgcgagtccg       240
     gcgccgacgt ctccggccgt cgtgagagac gaccggaaag atgagggtcg taagctaccg       300
     atggagtgtc caatggtgga cgtcgccgat ccagagaacg tcgcggcggt ggcgagatct       360
     ttgggagatg cctccgacgt cgtggtcttc gccacgcagg acatcgagca ctggcgcgct       420
     gaattcctcg tcaacgtcat cctcaacctc atgtccgtga acgtcacgtc ggtggtcacc       480
     gtggggaggc acaagcacac gtgcgagagc gcgagacgcg acaaccccga cgtcgtccga       540
     tgctgcgtct acagcacgtg gctcgacggc cacgacgcgc tcaaacgttg gaccttagcc       600
     gaggaccacg cgtacgtcct gtggctgatc cggtacaggt tcgcgctgga catcatgcgc       660
     gccggtgagg tgggcgtgct ggtgtcggac agcgacatgt ggttcgaacg cgacccgttc       720
     gagctgctca aagacgccgc cacgggcctc ggaacgcact cggtcgtcgc caacgtggag       780
     ggcgaaccgt ttccgtccat gaacggcggg ttggtctact tccgtgccga cctacccggt       840
     aaaggcgggc ggtacctcct ggaggttttt aacgaccacg tggatgattt attggcggac       900
     gaatcgcccc ccgagtgtca caaggagcaa ggggtcggga cgcaggttgt ctggggcgcg       960
     atgatggacc aagatatcct gagagacgcg gcggagacgg cggtggcggg tgcgccgctg      1020
     tggtggtcgt acacgcacca cgtgtgcctg ttcaagggcg ggtacgacga ggcgaccaag      1080
     gcgaagatgg agataaagag caagcacccg gagacgctgg actggagtcg atcggggcgc      1140
     tcgctgccgc gcccgttcca gtcgcacccc gccgtggagg cgctcggtga tgagcacccc      1200
     ctgaacgaat ccgaggagaa gtacgggatc atgaaagtcc cgaactatga gacctggcgc      1260
     aacctgacga tactcgcggc gcccaagtgg atgttcgcga accacggcga cggcgacggc      1320
     tggttcgcgc tgcgtccccg accgggcgcc gcgttccact gcatgtcgca gaaccagggc      1380
     atcaaaccgc gcatgctccg cgcgtacgac atgtggcact gggacgtcct gggcgccggg      1440
     cgggggatac gcgtcgggca gggacggtac ctgagcctgg cgtcggcggc ttttgggcac      1500
     tttaccaaac gcggggagtt tgcgatgcag gcgcacaggc tcgccgcgct cgccgccgcg      1560
     acggggcgaa tccccgtcct tcccatgatc ccctgcgcgt ccccgtggct cgatgactgg      1620
     cgacgcccgg acgactgcta cgcgggcgtc ctcgaacgca taaacgtcct cgcggggacg      1680
     tgccccgtca ccgcgctgcg gcagttccag ggccccgacg ccgcgtaccc cggcgacccg      1740
     gcggcagagg gttcggtggg ctcgccgtgc tgttacttcg ttcccccggg cgacgactgc      1800
     gaggaaaagt tcgcggcgtg gggcgccgag atgacgggcg aggacccgca caatcgaccc      1860
     ggacgcacgg tgcggctgga cgcgatcatc gacgcggcac agctggtcgt ggacgcgggc      1920
     gacgcgacgg agtacgcgga ccgaagctgg gtgctcgggg acgacttccc gccggacaac      1980
     gcgaagcacc ccacggacgt gttcgtggac tttgggcgcg tcgtgaaggc gattgaaggg      2040
     gacggggatc aaaacacgcc gtgggtggag atcgacatgc ggggtaagga cgcgctgccc      2100
     cgggtggtga cgcagcgggg cgtcgacgat aaaagccggc ggaagtggtt catggattac      2160
     aacgccgcgt gtcccctcgt caacagggtg tcgccgatgg tgtga                      2205
//

If you have problems or comments...

PBIL Back to PBIL home page