(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE343

MICSR_1.PE343        Location/Qualifiers
FT   CDS_pept        complement(667974..668336)
FT                   /codon_start=1
FT                   /gene_family="HOG000039506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636973"
FT                   /orf_name="MICPUN_56920"
FT                   /product="Predicted protein"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO62191.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG716384"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniParc:UPI000199A7CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M0"
FT                   /transl_table=1
FT                   /translation="MMNEAARPIVSLYRQILRAHYKCLPPPMRVLGDGYAREEFRRHLD
FT                   SKSMTNDRWIEFASEWSRYLANVAPKEEGAGPKFTGELSKETIDAMSEEQRMMLRKLKE
FT                   EAQSFGESVKADEETK"
     atgatgaacg aggcggcgag gccgatcgtc agcctctaca ggcagatact ccgggcgcac        60
     tacaagtgcc tacccccgcc catgcgcgtc ctcggcgacg ggtacgcgcg cgaggagttt       120
     cggcgacacc tggactcgaa gagcatgacg aacgatcggt ggatcgaatt cgcgagcgag       180
     tggtcgcgat acctcgcaaa cgtcgcgccc aaagaggagg gcgcgggacc gaagttcacg       240
     ggagagctat cgaaggagac catcgacgcc atgtcggagg agcagcggat gatgctccgg       300
     aagctcaagg aggaggcgca gtccttcgga gaatccgtca aggcggatga ggagacaaag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page