(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE344

MICSR_1.PE344        Location/Qualifiers
FT   CDS_pept        complement(668395..668649)
FT                   /codon_start=1
FT                   /gene_family="HOG000264686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636974"
FT                   /orf_name="MICPUN_56921"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO62192.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG560151"
FT                   /db_xref="InterPro:IPR005683"
FT                   /db_xref="UniParc:UPI000199A7CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M1"
FT                   /transl_table=1
FT                   /translation="MEIQPAAEPNRSSKPFGAADAWHVSKKLAWHTGKAAWQFGTSFLI
FT                   LVVPLVIQLHREEQMMALEQEQMGVLQSPTGNAEPTPTA"
     atggaaatcc agcccgccgc cgagcccaac cgcagctcca agcccttcgg cgccgcggac        60
     gcgtggcacg tgtccaagaa gctcgcgtgg cacaccggca aggctgcgtg gcagttcggc       120
     acctccttcc tcatcctcgt ggtgcccctc gtgatccagc tgcacaggga ggaacagatg       180
     atggccctcg agcaggagca gatgggcgtg ctccagtccc ccaccggtaa cgccgagccc       240
     acgcccaccg cgtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page