(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE345

MICSR_1.PE345        Location/Qualifiers
FT   CDS_pept        join(669430..669562,669808..669979,670325..670904)
FT                   /codon_start=1
FT                   /gene_family="HOG000264687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636975"
FT                   /orf_name="MICPUN_56922"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61765.1"
FT                   /db_xref="UniParc:UPI000199A829"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M2"
FT                   /transl_table=1
FT                   /translation="MANMANMFALLDEDAPKAAPAKENKPAAAAAPAKKAPAKTGDKPA
FT                   GNRNNGNAKRAPRAPREFEGSVEGTEGGRSRPRNADRRKPKDGEGGRRDRADRSGRGHE
FT                   GPHRGGAGKGGWGKPGDELNAPKEGDDAEPEPEPEEPDNEISIEDFEAAKAAKKAALNA
FT                   AMAKGATAKEVDSSAFASMTLAAKSEDVNEFSLDGAGPKAKRERERKAKEAAKLELGFK
FT                   SAPTAPAEDRPARGPGGRGGRGDRREGAGRGGRGEGRGGRGGRGGDRPAGGRGGSGLNV
FT                   KIEDSSAFPTLGK"
     atggctaata tggccaacat gttcgccctc ctcgacgagg acgctcccaa ggctgcccct        60
     gccaaggaga acaagcctgc cgctgcggct gcgcccgcca agaaggcgcc cgccaagacc       120
     ggcgacaagc ccgccggcaa ccgcaacaac ggcaacgcca agcgcgctcc ccgcgcccct       180
     cgcgagttcg agggctccgt cgagggcacc gagggcggcc gcagccgtcc ccgcaacgcc       240
     gatcgccgca agcccaagga cggcgagggc ggtcgtcgcg accgtgctga ccgctccggc       300
     cgtggccacg agggccccca ccgcggcggc gccggcaagg gcggctgggg caagcccggt       360
     gacgagctca acgcccccaa ggagggcgac gacgccgagc ccgagcccga gcccgaggag       420
     cccgacaacg agatctccat cgaggacttc gaggctgcca aggctgcgaa gaaggctgcc       480
     ctcaacgccg ccatggccaa gggcgccacc gccaaggagg ttgactcctc cgccttcgcc       540
     tccatgacgc tcgccgccaa atccgaggac gtcaacgagt tctccctcga cggcgccggt       600
     cccaaggcta agcgcgagcg cgagcgcaag gccaaggagg ccgccaagct cgagctcggc       660
     ttcaagtccg cacccaccgc ccccgccgag gaccgccccg cacgtggccc cggcggtcgc       720
     ggcggacgcg gcgacaggcg cgaaggcgcg ggccgcggcg gtcgcggcga gggccgcggc       780
     ggccgcggcg gccgcggcgg cgaccgcccc gccggcggtc gcggcggctc cggcctcaac       840
     gtcaagatcg aggactcctc cgccttcccc accctcggca agtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page