(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE346

MICSR_1.PE346        Location/Qualifiers
FT   CDS_pept        join(671829..672601,672665..672710,672744..674036)
FT                   /codon_start=1
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636976"
FT                   /orf_name="MICPUN_79742"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA topological change"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO61766.1"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="HOGENOM:HBG304889"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199A82A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M3"
FT                   /transl_table=1
FT                   /translation="MPSRGASSSVTPREAIAVGDEEAGGAPRDNTGDIIAAKAAAKAAA
FT                   AAATGGSDAYGASSIQVLKGLEPVRKRPGMYIGNTSTKGLHHMVWEVLDNGVDEVQAGH
FT                   ASLITVTVEADGSVAVEDDGRGIPTDVHPATGTSSLETVLTVLHAGGKFGGDESGYHVS
FT                   GGLHGVGISVVNALSDSTEVTVWRGDREYRQSFSRGAALAPMTEGSQDVANVGKKKGTR
FT                   VRFKPDPSIFKERQDFDPNIILARMKELAFLNSTATDEASMDEGDVKKTEEYYEEVLSF
FT                   PGGLKDYVVDLNEGAEPLHEPITFRAEVDGVQVEGALQWTKEAYTDTLLGYANSIRTSD
FT                   GGTHLDGLKQSLTRAVNTQARKAKLLKEADANLGGEHIREGLSAVIAVWVPQPEFEGQT
FT                   KTRLGNPEVRKVVESVIGEQVSEHLEFYPNTLGSIFSKASQAQKAAEAAKRARELVRRK
FT                   SVLRSGSLPGKLSDCSVSDPESTEIFLVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVE
FT                   RKDEASMYKNTEISSMVTALGLGLKGEPFDESQLRYSKIVILTDADVDGAHIRTLLLTF
FT                   LFRYQRGLFEQGKVYVAVPPLYKVESGRAGKNNPPTYCYDEAQLQAHLATLPEGASRSI
FT                   QRFKGLGEMMPEQLWSTTLNPETRLLKRLTVDDAAMANKTFQLLMSDKVAPRREFIETE
FT                   GPKLEDIDV"
     atgccctcgc gcggcgcctc ctcctccgtc accccgcgcg aggccatcgc ggtgggcgac        60
     gaggaggccg gcggcgcgcc ccgcgacaac accggcgaca tcatcgccgc caaagccgcc       120
     gccaaagccg ccgcagccgc cgccaccggg ggctccgacg cgtacggagc ctcctccatc       180
     caggtcctca agggcctcga gcctgtgcga aagcgaccgg ggatgtacat cggcaacacc       240
     agcaccaagg gcctgcacca catggtgtgg gaagtgttgg acaacggcgt ggacgaggtc       300
     caggcgggac acgcgtcttt gatcaccgtc accgtggagg ctgacgggag cgtcgccgtc       360
     gaggatgacg gtcgaggcat cccgacggat gtacacccgg cgacgggcac gagctcgctg       420
     gagacggtgc tcacggtgct gcacgcggga ggtaagtttg gcggcgacga gagcgggtac       480
     cacgtctcgg gcggcctgca cggcgtgggc atctccgtcg tgaacgccct gagcgactcg       540
     acggaggtga cggtttggag gggagatcgc gagtaccggc agtcgttcag ccgcggcgcc       600
     gcgctcgcgc cgatgacgga ggggtcgcaa gacgtcgcga acgtcgggaa gaaaaaggga       660
     acgcgggtga ggttcaagcc ggacccgagc atcttcaagg agaggcagga tttcgatccc       720
     aacatcatcc tcgcgaggat gaaggagctg gcttttctga actccacggc gacggatgag       780
     gcctcgatgg acgagggtga cgtgaagaag accgaggagt actacgagga ggtgctctcc       840
     ttccccggcg gtttgaagga ctacgtggtg gacctcaacg agggcgccga gccgctccac       900
     gagcccatca ccttccgcgc cgaggtggac ggcgtgcagg tggagggcgc gctgcagtgg       960
     acgaaggagg cgtacaccga tacgctgctc ggttacgcca acagcatcag aaccagcgac      1020
     gggggcacgc acctcgacgg cttgaagcag tcgctcacgc gcgcggtgaa cactcaggcg      1080
     aggaaggcga agctgctgaa ggaggcggac gctaacctgg gcggcgagca catccgcgag      1140
     ggcctgagcg cggtcatcgc ggtgtgggtg ccccaacccg agtttgaggg ccagaccaag      1200
     accaggttgg gtaaccccga ggtgaggaag gttgtcgaga gcgtcatcgg cgagcaggtc      1260
     tcggagcacc tcgagtttta cccaaacacg ctcggcagca tcttcagcaa ggcgagccag      1320
     gcgcaaaagg cggcggaggc ggcgaagcgc gcgagggagc tggtgcgccg caagagcgtc      1380
     ctgcgcagcg gctcgcttcc cggaaagctc tccgactgca gcgtcagcga cccggagagc      1440
     acggagattt tcctcgtgga gggcgactcc gcgggcggca gcgcgaagca gggccgcgac      1500
     aggcgcttcc aggcggtgct cccgctgcgg ggtaagatcc tcaacgtcga gcgcaaggac      1560
     gaggcgagca tgtacaagaa caccgagatt tcctccatgg tcaccgcgct cgggctgggt      1620
     ttaaaggggg agcccttcga cgagtcgcag ctgaggtaca gcaagattgt catcctcacc      1680
     gacgccgacg tcgacggcgc gcacatccgg acgctgctgc tcaccttcct cttcaggtac      1740
     cagcgggggc tgttcgagca gggcaaggtt tacgtcgccg tgcccccgct gtacaaggtg      1800
     gagtctggcc gcgcgggcaa gaacaacccg ccgacgtact gctacgacga ggcgcagctc      1860
     caggcgcacc tcgcgacgtt acccgagggc gcgtccagga gcatccaaag gttcaagggt      1920
     ctgggcgaga tgatgcccga gcagctgtgg tcgacgacgc tgaacccgga gactcggctg      1980
     ctgaagcggc tgacggtgga cgacgcggcg atggcgaaca agacgttcca gctcctgatg      2040
     tcggacaagg tggcgcccag gagggagttc atcgagacgg agggacccaa gctcgaggac      2100
     atcgacgtgt ga                                                          2112
//

If you have problems or comments...

PBIL Back to PBIL home page