(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE347

MICSR_1.PE347        Location/Qualifiers
FT   CDS_pept        674186..674542
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636977"
FT                   /orf_name="MICPUN_56924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61767.1"
FT                   /db_xref="UniParc:UPI000199A82B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M4"
FT                   /transl_table=1
FT                   /translation="MASLRLSSVTGSGLLLRTGGGSGGGRAGGGRWQSHWQPTTRSTSS
FT                   SSSSSSSSSSSSSSCSTTTTSSSSSGIRSSLCARRPRMFCPQNNPERQPPGRSCSCLSL
FT                   RRLITLYSYCSPSS"
     atggcgtcgc tgaggttgtc gagcgtcacc ggctcgggtc tcctcctgag gacgggcggg        60
     ggtagcgggg gaggccgagc gggtggcggc cggtggcagt cgcactggca gcctactact       120
     cgctccacct cctcctcctc ctcctcttcc tcctcctcct cctcctcctc ctcctcctgc       180
     tccaccacca ccacctcctc ctcctcttca ggcatccgat cctccctttg cgcgcgtcgt       240
     ccgcggatgt tctgtccaca gaataatccg gagaggcagc cccccggccg ctcctgctcc       300
     tgtctcagcc tgcgcaggtt gataactttg tactcgtact gttccccctc ctcttga          357
//

If you have problems or comments...

PBIL Back to PBIL home page