(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE348

MICSR_1.PE348        Location/Qualifiers
FT   CDS_pept        join(complement(676280..676282),complement(675803..675961),
FT                   complement(675001..675555))
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636978"
FT                   /orf_name="MICPUN_106801"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /function="transcription regulator activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO62193.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI000199A82C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M5"
FT                   /transl_table=1
FT                   /translation="MPAVPETALKRRKRDEAWAANKAKAAAEAKAKAEANKKEIFNRAE
FT                   KYVKEYRDQEADLVRLKREARAKGGFYVEPEAKVMFVMRLRGINDMHPKTRKIMQLLRL
FT                   RQIHNGVFMRVNKATINMLRKVEPYVMFGYPNLKSVKELIYKRGYGKVNKQRIPLTDNS
FT                   IIEKALGEKGIICIEDLIHEIYTCGPHFTACSNFLWPFKLSAPLGGMTKKRLHYIEGGE
FT                   AGNREDKINALIRRMN"
     atgcccgctg ttcccgagac cgctcttaag cgtcgtaagc gcgacgaggc gtgggccgcc        60
     aacaaggcca aggccgccgc ggaggccaag gctaaggccg aggccaacaa gaaggagatc       120
     ttcaaccgcg cggagaagta cgtgaaggag tatcgtgatc aggaggctga cctggttcgc       180
     ctcaagcgcg aggctcgcgc caagggcggc ttctacgtcg agcccgaggc taaggtcatg       240
     ttcgtcatgc gccttcgcgg tatcaacgac atgcacccca agacccgcaa gatcatgcag       300
     ctcctccgcc tgcgccagat ccacaacggt gtcttcatgc gcgtgaacaa ggcgactatc       360
     aacatgctga ggaaggttga gccctacgtc atgttcggct accccaacct caagtcggtg       420
     aaggagctca tctacaagcg cgggtacggc aaggtgaaca agcagcgcat ccccctcacc       480
     gacaactcca tcattgagaa ggcgctcggc gagaagggca tcatctgcat tgaggatctc       540
     atccacgaga tctacacctg cggcccccac ttcaccgctt gctccaactt cctctggccc       600
     ttcaagctgt ctgcccctct cggcggcatg accaagaagc gcctgcacta catcgagggt       660
     ggcgaggctg gtaaccgcga ggacaagatc aacgcgctca tccgccgcat gaactaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page