(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE349

MICSR_1.PE349        Location/Qualifiers
FT   CDS_pept        join(676751..676843,676963..677072,677214..677823)
FT                   /codon_start=1
FT                   /gene_family="HOG000264682" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636979"
FT                   /orf_name="MICPUN_56926"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61768.1"
FT                   /db_xref="HOGENOM:HBG560154"
FT                   /db_xref="InterPro:IPR005491"
FT                   /db_xref="UniParc:UPI000199A82D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M6"
FT                   /transl_table=1
FT                   /translation="MGAGVGEQVRKLELDAYQAFLKVTAVTGMSWERDDLATKLRQELN
FT                   ISNDDHTRIREKLSDDERIKTIRENWKQREINQAAKKARIDAGGFTGAKTPKAPASAKP
FT                   KAAPKAKTPKGPAAAPIVVNELICRRVQRFWPDEGGWFDAIITDYRPTTNEHCLTYEIN
FT                   TPNETFEWADISQFDGREFKLLEDRVNIEDLKFYSQGMKVGAETATHNQAIVATHAAVG
FT                   DVNKIVQKAAKTADVDKIVEAKGTLSAQEEALRAQLAALDSDSDSDED"
     atgggagcgg gagtcggcga gcaggttcgc aagcttgagc tcgacgccta ccaggccttc        60
     ctgaaggtca cggcggtcac tggcatgtcg tgggagcgag acgacctcgc gaccaagctc       120
     aggcaggagc tcaacatctc caacgatgat cacacccgca tcagggagaa actctcggac       180
     gatgagcgca tcaagaccat cagggagaac tggaaacaga gggagatcaa ccaggccgcc       240
     aagaaggcgc gcatcgacgc cggcggcttc accggcgcca agaccccgaa ggcccccgcc       300
     tctgccaagc cgaaggcggc gcccaaggcg aagacgccca agggacccgc cgcggctccc       360
     atcgtcgtca acgagctcat ctgccgccgc gtccagaggt tctggccgga cgagggcggt       420
     tggttcgacg ccatcatcac cgactaccgc cccaccacca acgagcactg cctgacgtac       480
     gagatcaaca ccccgaacga gactttcgag tgggccgaca tctcgcagtt cgacggtcgg       540
     gagttcaagc tgctggagga ccgggtcaac atcgaggacc tcaagttcta cagccagggc       600
     atgaaggtcg gggcggagac ggcgacgcac aaccaggcca tcgtggccac gcacgcggca       660
     gtgggcgacg tgaataagat tgtccagaag gccgcgaaaa ccgcggacgt cgacaagatc       720
     gtcgaggcga agggaacgct cagcgcgcag gaggaggcgc tcagggcgca gctcgccgct       780
     ctcgacagcg acagcgacag cgacgaggat taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page