(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE35

MICSR_1.PE35         Location/Qualifiers
FT   CDS_pept        join(62719..62808,62902..63022,63113..63387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636040"
FT                   /orf_name="MICPUN_56608"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61601.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199AB2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R2"
FT                   /transl_table=1
FT                   /translation="MSAFVQSAFTTGGSTFVRARPQTRRAPATRASGRVSLRVQAIAEG
FT                   RQSLFVAVTVKSGKMEEYEKLIKRHITNCYMNDRCMYFDFGVNQDGSDPNVVYLYEVYE
FT                   DEAALQEHRDSSHLKEYLSAAAELTDSHDVRTLNLAPYGSVNCNYAGQCEIGEGMWD"
     atgtcggctt tcgttcagag cgctttcacg accggcgggt ccacgttcgt tcgcgcgcgt        60
     ccccagaccc gccgcgcccc cgctaccagg gcctccgggc gggtatccct gcgcgttcag       120
     gccatcgcgg aaggtcgcca gtccctgttc gtcgccgtca ccgtcaaatc cggcaagatg       180
     gaggagtacg agaagctcat caagcgacac atcacgaact gctacatgaa cgacaggtgc       240
     atgtacttcg actttggggt gaaccaggac ggatcggatc ccaacgtcgt ctacctgtac       300
     gaggtgtacg aggacgaggc ggcgcttcag gagcaccggg acagctcgca cctgaaggag       360
     tatctgtcgg cggcggcgga gctcaccgac tcccacgacg tcaggacgct caacctcgcg       420
     ccgtacggct ccgtgaactg caactacgcc gggcagtgcg agataggtga gggtatgtgg       480
     gactag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page